KEGG   Blautia producta: PMF13cell1_05219Help
Entry
PMF13cell1_05219  CDS       T05894                                 

Definition
(GenBank) hypothetical protein
  KO
K09988  D-lyxose ketol-isomerase [EC:5.3.1.15]
Organism
bpro  Blautia producta
Pathway
bpro00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:bpro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PMF13cell1_05219
Enzymes [BR:bpro01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.15  D-lyxose ketol-isomerase
     PMF13cell1_05219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyx_isomer Cupin_2
Motif
Other DBs
NCBI-ProteinID: QBE99640
UniProt: A0A4P6M777
Position
complement(5899662..5900360)
Genome map
AA seq 232 aa AA seqDB search
MKRSELNKIICEAIDFAEDKGIKFPPFAKWSIEDWKKVGEQEKELVDNMLGWDVTDFGSG
DFKKCGLLIFTFRNGNFYDKETYPKPYAEKLLLVDDGQELPYHFHWSKMEDIINRGGGNL
IVQLYNADENEGFADTDVTVTVDGQKRKVPAGGKVTIEPGQSITLLPGQYHRWEGEKGTG
KVMLFEVSTTNDDMTDNRFYEAKERIPNIVEDEEPQYLIFDDYKEYVSLSKR
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgttcagaactaaataaaattatctgcgaagccattgattttgctgaggataag
ggaataaaatttccgccttttgcaaaatggagcatagaggattggaaaaaagtgggggag
caggagaaagaactggtagataacatgctgggctgggatgtcacagattttggcagcggg
gatttcaaaaaatgcggccttttgatttttacattccgcaatgggaatttttatgataaa
gaaacttatccgaaaccatatgcagagaaactattgttggtagatgatgggcaggaactg
ccttatcactttcattggagcaagatggaagatattattaacagaggaggaggaaatctt
attgtccagctatataatgcagatgaaaatgagggttttgccgatacagatgtgactgtg
acagtagatggacaaaaaagaaaggttcctgcaggagggaaagtaaccattgaaccgggg
cagagcataactctgcttcccggacaatatcaccgctgggagggggagaaggggaccggg
aaagtgatgttgtttgaagtctccaccacaaatgatgatatgacggataatcgtttctat
gaagcgaaggagaggattcccaatattgtggaagatgaagaacctcaatatcttatattt
gatgattataaagagtatgtatcattgagtaagagataa

DBGET integrated database retrieval system