KEGG   Butyrate-producing bacterium SS3/4: CK3_18910Help
Entry
CK3_18910         CDS       T02611                                 

Definition
(GenBank) acetyl-CoA acetyltransferases
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bprs  Butyrate-producing bacterium SS3/4
Pathway
bprs00071  Fatty acid degradation
bprs00072  Synthesis and degradation of ketone bodies
bprs00280  Valine, leucine and isoleucine degradation
bprs00310  Lysine degradation
bprs00362  Benzoate degradation
bprs00620  Pyruvate metabolism
bprs00630  Glyoxylate and dicarboxylate metabolism
bprs00640  Propanoate metabolism
bprs00650  Butanoate metabolism
bprs00900  Terpenoid backbone biosynthesis
bprs01100  Metabolic pathways
bprs01110  Biosynthesis of secondary metabolites
bprs01120  Microbial metabolism in diverse environments
bprs01130  Biosynthesis of antibiotics
bprs01200  Carbon metabolism
bprs01212  Fatty acid metabolism
bprs02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bprs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CK3_18910
   00630 Glyoxylate and dicarboxylate metabolism
    CK3_18910
   00640 Propanoate metabolism
    CK3_18910
   00650 Butanoate metabolism
    CK3_18910
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CK3_18910
   00072 Synthesis and degradation of ketone bodies
    CK3_18910
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CK3_18910
   00310 Lysine degradation
    CK3_18910
   00380 Tryptophan metabolism
    CK3_18910
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CK3_18910
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CK3_18910
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CK3_18910
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bprs04147]
    CK3_18910
Enzymes [BR:bprs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CK3_18910
Exosome [BR:bprs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CK3_18910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III Ketoacyl-synt_C
Motif
Other DBs
NCBI-ProteinID: CBL41523
UniProt: D7GUN1
Position
complement(1925279..1926463)
Genome map
AA seq 394 aa AA seqDB search
MAKKIVLAGACRTAIGTMGGELSTVPAPELGAIVIKEALKRAGVAPEAVDQVYMGCVIQA
GQGQNVARQATLKAGLPIEVPAVTINVVCGSGLEAVNMAAEMILSGDADIVVAGGMENMS
MAPYAMMKGRYGYRMGNATLVDTMVNDALWDAFNNYHMGITAENICDQWGLTREELDKFA
AVSQQKAEAAQKSGAFKDEIVPVEVKKKKETVIVDTDEGPRHGTTVETLGKLKPAFKKDG
GLVTAGNSSGINDGAAAVVVMSEEKAKELGVKPMATWVAGALGGVDPKIMGIGPVAATRK
VLKRTGMEIKDFDIIEANEAFAAQSVAVGKELGFDLNKLNPNGGAIALGHPVGASGCRIL
VTLLHEMEKADAKKGLATLCIGGGMGCATIVERD
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaaaattgtactggcaggtgcatgccgtaccgcaatcggaacaatgggtggc
gaattaagtacagtaccggctccggaacttggcgcgatcgtaattaaagaggctttaaag
agagcaggtgtagctccggaagctgttgatcaagtttacatgggctgtgtaatccaggct
ggccagggacagaacgtagctcgtcaggctacattaaaagctggtctcccgatcgaggtt
ccggctgtaacgatcaacgtagtatgcggttccggtcttgaggctgttaacatggcagct
gagatgatcctttccggtgacgctgatatcgttgttgcaggcggcatggagaacatgtcc
atggctccgtatgctatgatgaaaggtcgttacggataccgtatgggcaatgctacctta
gttgatacaatggttaacgatgctctctgggatgcattcaacaactaccacatgggtatc
acagctgagaacatctgcgatcagtggggccttacaagagaagaactggacaagttcgct
gcagtaagccagcagaaggcagaggcagctcagaagtccggcgcattcaaggacgagatc
gttccggtagaagtcaagaagaaaaaagagacagttatcgtagatacagatgaaggcccg
cgtcacggaacaacggttgagactctcggtaagttaaaaccggcattcaagaaagacggc
ggcttagttacagctggtaattcttcaggaatcaacgacggtgcagcagcagttgttgtt
atgagcgaagagaaagctaaagagctcggtgttaagccgatggctacatgggttgccggt
gctctcggcggcgtagatccgaagatcatgggtatcggaccggttgcagctacaagaaaa
gttcttaagagaacaggcatggagatcaaagacttcgatatcatcgaggctaacgaggca
ttcgctgcacagtctgtagcagtaggtaaagagcttggctttgaccttaacaagttaaac
ccgaacggcggcgcgatcgctctcggacacccggtaggagcttccggatgccgtattctc
gttacacttcttcatgagatggagaaggcagatgctaagaagggtcttgcaactctttgc
atcggcggcggaatgggctgtgctacaatcgtagagagagactaa

DBGET integrated database retrieval system