KEGG   Butyrate-producing bacterium SS3/4: CK3_19150Help
Entry
CK3_19150         CDS       T02611                                 

Definition
(GenBank) EMAP domain
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bprs  Butyrate-producing bacterium SS3/4
Pathway
bprs00450  Selenocompound metabolism
bprs00970  Aminoacyl-tRNA biosynthesis
bprs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bprs00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CK3_19150
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CK3_19150
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bprs01007]
    CK3_19150
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bprs03016]
    CK3_19150
Enzymes [BR:bprs01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CK3_19150
Amino acid related enzymes [BR:bprs01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CK3_19150
Transfer RNA biogenesis [BR:bprs03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CK3_19150
 Prokaryotic type
   Other AARSs
    CK3_19150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_bind
Motif
Other DBs
NCBI-ProteinID: CBL41543
UniProt: D7GUQ1
Position
complement(1952971..1953345)
Genome map
AA seq 124 aa AA seqDB search
MDKMAEKEEVTAETSTEDAEKVVVEPYDAADIDFDTFCKSDMRVVKVKDCVAVKKSKRLL
QFTLDDGSGTDRTILSGMHSYYEPEELVGKTLVAIVNIPPRAMMGIVSHGMFLSAECKKG
KMRL
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggataaaatggcagagaaagaggaagtaaccgctgagacttccacagaagatgcagaa
aaggttgtagtagagccttatgatgcagcagatatcgattttgatacattctgcaaatca
gatatgagagtggtaaaagtaaaagactgtgttgcagtgaaaaaatccaaaaggctgctg
cagtttacattagatgatggtagtggaacagatcgtaccattctttccggaatgcattca
tattacgaaccggaggaactggttggcaagaccttagttgcgattgtcaacatcccgccg
agagctatgatgggaattgtatcccatggcatgtttctttctgctgaatgcaagaagggg
aagatgagattgtga

DBGET integrated database retrieval system