KEGG   Butyrate-producing bacterium SS3/4: CK3_31490Help
Entry
CK3_31490         CDS       T02611                                 

Definition
(GenBank) Pyruvate/oxaloacetate carboxyltransferase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
bprs  Butyrate-producing bacterium SS3/4
Pathway
bprs00620  Pyruvate metabolism
bprs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bprs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CK3_31490
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bprs02000]
    CK3_31490
Enzymes [BR:bprs01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     CK3_31490
Transporters [BR:bprs02000]
 Other transporters
  Primary active transporters [TC:3]
   CK3_31490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like TGT
Motif
Other DBs
NCBI-ProteinID: CBL42593
UniProt: D7GP58
Position
complement(3164217..3165629)
Genome map
AA seq 470 aa AA seqDB search
MAEVQKKPVKIVETVLRDAHQSLLATRMTTDQMLPIVDKMDKVGYYAVECWGGATFDACL
RFLKEDPWERLRKLRAGFKNTKLQMLFRGQNILGYNHYADDVVEYFVQKSIANGIDIIRI
FDCLNDIRNLETAVKATKKEGGHAQIALCYTLGDAYTLDYWKNIASEIESMGADSLCIKD
MAGLLTPYAATELVTALKQGTKLPIDLHTHYTSGVASMTYLKAVEAGCDIIDCAMSPLAL
GTSQPATEVMVETFRGTKYDTGYDQNLLAEITDYFTPIREEALKSGLLNPKVLGVNIKTL
QYQVPGGMLSNLVSQLKEAGQEDKYRAVLEEIPRVRKDFGEPPLVTPSSQIVGTQAVLNV
LAGERYKMVPKESKKIMMGEFGKTVKPFNKEVQKKIIGDATPITCRPADLIEPQLPKFEK
ECAQWKQQDEDVLSYALFPAVAKDFFEYREAQQTKVDQKTADKANKAYPV
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagttcagaaaaagccggttaagatcgttgagaccgttcttcgtgatgcacat
cagtctctccttgcaacaagaatgacgactgatcagatgcttccgatcgttgacaaaatg
gataaagttggctactacgcagtagaatgctggggcggcgctacttttgatgcctgcctg
cgtttcctgaaggaagatccgtgggagagactcagaaaactgagagctggattcaagaac
acgaagctccagatgctgttccgtggtcagaatatccttggatacaatcattatgcagat
gatgtggttgagtactttgtacagaaatccatcgcaaatggtattgatattatccgtatt
tttgactgcctgaatgatatcagaaaccttgagactgccgttaaggcaacaaaaaaggaa
ggcggacatgcccagatcgccctttgctatacattaggcgatgcgtatacacttgattac
tggaagaatatcgcttccgagatcgagagcatgggcgctgattccctctgcatcaaggat
atggcaggtctgttaactccgtatgcggctactgagcttgttacggcattaaaacagggt
acaaagctgccgatcgacctgcacacgcactatacctccggtgttgcttccatgacatat
ttaaaggctgtggaagcaggctgcgatatcattgactgcgcaatgtctccgctggctctc
ggtacatcccagccggcaactgaagttatggttgagacattccgcggcaccaagtatgat
actggctatgaccagaatctgcttgcagagatcaccgattacttcacaccgatccgtgag
gaagctttaaagagcggccttctgaacccgaaggttctcggtgtaaacatcaagacgctc
cagtatcaggtaccgggcggaatgctttccaaccttgtttcccagttaaaggaagctggc
caggaagacaagtaccgcgcagtgcttgaggagatcccgagagtaagaaaagacttcggt
gagccgccgcttgtaactccgtcctcccagatcgttggtacacaggctgtattgaacgtt
cttgccggcgagagatataagatggttccgaaggagtccaagaagatcatgatgggcgaa
tttggtaagacggtaaaaccgttcaacaaagaagtccagaagaagatcatcggcgatgca
actccgatcacctgtcgtccagcagacctgatcgagccgcagctgccgaaattcgagaag
gaatgcgcacagtggaagcagcaggatgaggatgtattatcctatgctctgttcccggct
gtagcaaaagacttcttcgagtaccgtgaagcccagcagacgaaggttgaccagaagact
gcagacaaagcaaataaagcttacccggtataa

DBGET integrated database retrieval system