KEGG   Burkholderia pseudomallei K96243: BPSL0355
Entry
BPSL0355          CDS       T00203                                 

Name
(GenBank) putative inward rectifier potassium channel protein
  KO
K08715  inward rectifier potassium channel
Organism
bps  Burkholderia pseudomallei K96243
Brite
KEGG Orthology (KO) [BR:bps00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bps02000]
    BPSL0355
Transporters [BR:bps02000]
 Other transporters
  Pores ion channels [TC:1]
   BPSL0355
SSDB
Motif
Pfam: IRK_C Ion_trans_2 IRK Ion_trans
Other DBs
NCBI-ProteinID: CAH34343
UniProt: H7C748
Structure
PDB: 
2WLL 1P7B

Position
1:378316..379317
AA seq 333 aa
MNVDPFSPHSSDSFAQAASPARKPPRGGRRIWSGTREVIAYGMPASVWRDLYYWALKVSW
PVFFASLAALFVVNNTLFALLYQLGDAPIANQSPPGFVGAFFFSVETLATVGYGDMHPQT
VYAHAIATLEIFVGMSGIALSTGLVFARFARPRAKIMFARHAIVRPFNGRMTLMVRAANA
RQNVIAEARAKMRLMRREHSSEGYSLMKIHDLKLVRNEHPIFLLGWNMMHVIDESSPLFG
ETPESLAEGRAMLLVMIEGSDETTAQVMQARHAWEHDDIRWHHRYVDLMSDVDGMTHIDY
TRFNDTEPVEPPGAAPDAQAFAAKPGEGDARPV
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgaacgtcgatcctttttccccgcattcctccgattctttcgcgcaggccgcctcaccc
gcgcgcaagccgccgcgcggcggccgccggatctggtccggcacgcgcgaggtgatcgca
tacggcatgccggcgtccgtctggcgcgacctctactactgggcgctgaaggtgagctgg
cccgtgttcttcgcgtcgctcgccgcgctgttcgtcgtcaacaacacgctgttcgcgctg
ctgtatcagttgggcgacgcgccgatcgcgaaccagtcgccgcccggcttcgtcggcgcg
ttcttcttcagcgtcgagacgctcgccaccgtcggctacggcgacatgcatccgcagacc
gtctacgcgcacgcgatcgcgacgctcgagatcttcgtcgggatgtcggggatcgcgctg
tcgacggggctcgtgttcgcgcgtttcgcgcggccgcgcgcgaagatcatgttcgcgcgt
catgcgatcgtgcgcccgttcaacggccggatgacgctgatggtgcgcgcggcgaacgcg
cggcagaacgtgatcgccgaggcgcgcgcgaagatgcggctgatgcggcgcgagcactcg
tccgaggggtattcgctgatgaagatccacgatctgaagctcgtgcgcaacgagcatccg
atcttcctgctcggctggaacatgatgcacgtgatcgacgagtcgagcccgctgttcggc
gagacgcccgagtcgctcgccgagggccgcgcgatgctgctcgtgatgatcgagggctcg
gacgagaccaccgcgcaggtgatgcaggcgcgccacgcgtgggagcacgacgacatccgc
tggcaccaccgctacgtcgatctgatgagcgacgtcgacggcatgacgcacatcgactac
acgcgctttaacgacaccgagccggtcgagccgccgggggcggcgcccgatgcgcaggcc
ttcgccgcgaagcccggcgaaggcgacgcgcgcccggtctga

DBGET integrated database retrieval system