KEGG   Burkholderia pseudomallei K96243: BPSL0371Help
Entry
BPSL0371          CDS       T00203                                 

Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps00071  Fatty acid degradation
bps00072  Synthesis and degradation of ketone bodies
bps00280  Valine, leucine and isoleucine degradation
bps00310  Lysine degradation
bps00362  Benzoate degradation
bps00380  Tryptophan metabolism
bps00620  Pyruvate metabolism
bps00630  Glyoxylate and dicarboxylate metabolism
bps00640  Propanoate metabolism
bps00650  Butanoate metabolism
bps00900  Terpenoid backbone biosynthesis
bps01100  Metabolic pathways
bps01110  Biosynthesis of secondary metabolites
bps01120  Microbial metabolism in diverse environments
bps01130  Biosynthesis of antibiotics
bps01200  Carbon metabolism
bps01212  Fatty acid metabolism
bps02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BPSL0371
   00630 Glyoxylate and dicarboxylate metabolism
    BPSL0371
   00640 Propanoate metabolism
    BPSL0371
   00650 Butanoate metabolism
    BPSL0371
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BPSL0371
   00072 Synthesis and degradation of ketone bodies
    BPSL0371
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BPSL0371
   00310 Lysine degradation
    BPSL0371
   00380 Tryptophan metabolism
    BPSL0371
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BPSL0371
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BPSL0371
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BPSL0371
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bps04147]
    BPSL0371
Enzymes [BR:bps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BPSL0371
Exosome [BR:bps04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BPSL0371
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 3092743
NCBI-ProteinID: YP_106997
UniProt: Q63Y18
Position
1:complement(400265..401458)
Genome map
AA seq 397 aa AA seqDB search
MTAVDQDPIVIASAARTPIAGFQGEFASLAAPQLGAAAIAAALERAGLQPEQIDEAVMGC
VLPAGQGQAPARQAALGAKLPLSVGCTTINKMCGSGMRAAMFAHDMLVAGSVDVIVAGGM
ESMTNAPYLLPKARAGMRMGHGQVLDHMFLDGLEDAYDKGRLMGTFAEECAGEYAFSRDA
QDAFAIESLARAKRANEDGSFAWEIAPVTVAGKKGDAVIARDEQPFKANPEKIPTLKPAF
SKTGTVTAANSSSISDGAAALVMMRASTANRLGLAPLARVVGHSTFAQAPSKFTTAPVGA
IRRLFEKNGWRAAEVDLYEINEAFAVVTMAAMKEHGLPHEKVNVNGGACALGHPIGASGA
RILVTLIGALRARGAKRGVASLCIGGGEATAMGIELI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacggctgttgatcaggatccgatcgtcatcgcatcggcggcgcgcacgccgatcgcg
ggctttcagggcgagttcgcgtcgctcgccgcgccgcagctgggcgcggccgcgatcgcc
gcggcgctcgagcgcgcgggcctgcaaccggagcagatcgacgaggcggtgatgggctgc
gtgctgcccgccgggcaggggcaggcgccggcacggcaggcggcgctcggcgcgaagctg
ccgctgtcggtcggctgcacgacgatcaacaagatgtgcggctcgggcatgcgcgcggcg
atgttcgcgcacgacatgctcgtggcgggctccgtcgacgtgatcgtcgcgggcggcatg
gaaagcatgacgaacgcgccgtacctgctgccgaaggcgcgcgccggcatgcgcatgggc
cacggccaggtgctcgaccacatgttcctcgacggcctcgaggacgcctacgacaagggc
cggctgatgggcacgttcgccgaggaatgcgcgggcgaatacgcgttctcgcgcgacgcg
caggacgcgttcgcgatcgaatcgctcgcgcgcgcgaagcgggcgaacgaggacggctcg
ttcgcgtgggaaatcgcgcccgtgacggtggccggcaagaagggcgatgcggtgatcgcg
cgcgacgagcagccgttcaaggcgaaccccgagaagattccgacgctcaagcccgcgttc
agcaagacgggcaccgtgaccgccgcgaattcgtcgtcgatctccgacggcgcggccgcg
ctcgtgatgatgcgcgcgtcgacggcgaaccggctcgggctcgcgccgctcgcgcgcgtc
gtcggccattcgacgttcgcgcaggcgccgtcgaagttcacgacggcgcctgtcggcgcg
atccggcgcctgttcgagaagaacggctggcgcgcggccgaggtcgacctgtacgagatc
aacgaagcgttcgcggtcgtcacgatggcggcgatgaaggagcacggcctgccgcacgag
aaggtcaacgtgaacggcggcgcgtgcgcgctcggccatccgatcggcgcgtcgggcgcc
cgcatcctcgtcacgctgatcggcgcgctgcgcgcgcgcggggccaagcgcggcgtggcg
agcctgtgcatcggcggcggcgaagcgaccgcgatgggcatcgagctgatctga

DBGET integrated database retrieval system