KEGG   Burkholderia pseudomallei K96243: BPSL0659Help
Entry
BPSL0659          CDS       T00203                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase
  KO
K03771  peptidyl-prolyl cis-trans isomerase SurA [EC:5.2.1.8]
Organism
bps  Burkholderia pseudomallei K96243
Brite
KEGG Orthology (KO) [BR:bps00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bps03110]
    BPSL0659
Enzymes [BR:bps01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     BPSL0659
Chaperones and folding catalysts [BR:bps03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Parvulin
    BPSL0659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rotamase Rotamase_3 SurA_N Rotamase_2 SurA_N_3 SurA_N_2 Trigger_C
Motif
Other DBs
NCBI-GeneID: 3094814
NCBI-ProteinID: YP_107288
UniProt: Q63X78
Position
1:749757..751109
Genome map
AA seq 450 aa AA seqDB search
MAMKKILRFAAVASGLVASLITVAPSASAQALRAQGASLADEVVAVVNNDVITGRELDQR
VGLIARRLQQQKAPVPPTDQLRAQVLNQMVLERIQVQRAKDDGIVVDNATVQATLGRLAQ
ANGMQLDQYKARIEAQGVPWDLFVRDARTELMLSKLREKEVDSKITVSDAEVASYIASQR
GPNAGSQQDLRLEHIFVKAPANAPQADIDVAQKKAEGLLQQALASGANFERLAKNQSEAD
DAKKGGDLGFKSPASLPSDVVDAVSKLRPGEVNPTLIRVPDGFEIVRLVERRASQNPAAS
PKIVQTHVRHILLRVGEGKSESQARQQLIDIRRQIESGGDFEKFARTYSQDGSASQGGDL
GWISPGETVPEFERAMNTLQDGQVSNPVRTEYGYHLIQVLGRRDAEGSVQQQMDIARQAI
GQRKAEQAYSDWLRELRDSSYVQIKLPVAQ
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
gtggcaatgaagaaaatccttcgcttcgcggctgtcgcatccggtctggtcgcgtcgctc
atcacggtcgcgccgtcggcgtccgcgcaggcgttgcgcgcgcagggcgcgtcgctcgcc
gacgaggtggtcgccgtcgtcaacaacgacgtgatcaccgggcgcgagctcgatcagcgc
gtcggcctgatcgcgcgccgcctgcagcagcagaaggcgcccgtgccgccgacggaccag
ttgcgcgcgcaggtgctcaaccagatggtgctcgagcgtatccaggttcagcgggcgaag
gacgacggcatcgtcgtcgacaacgcaaccgtgcaggcgacgctcggccgcctcgcgcag
gcgaacggcatgcagctcgaccagtacaaggcgcgcatcgaggcgcagggcgtgccgtgg
gatctgttcgtgcgcgacgcgcgcaccgagctgatgctctcgaagctgcgcgagaaggaa
gtcgacagcaagatcaccgtgtcggacgccgaggtggcgagctatatcgcgagccagcgc
ggcccgaacgcgggctcgcagcaggatctgcggctcgagcacatcttcgtgaaggcgccg
gccaacgcgccgcaggccgacatcgacgtcgcgcagaagaaggccgaaggcctgctgcag
caggctctcgcgtcgggcgccaatttcgagcggctcgcgaagaaccagtcggaagccgac
gacgcgaaaaagggcggcgatctcggcttcaagtcgccggcatcgctgccgtccgacgtc
gtcgacgccgtgtcgaagctgcgtcccggcgaggtcaacccgacgctcatccgcgtgccg
gacggcttcgagatcgtgcgcctcgtcgagcgccgcgcgagccagaatccggccgcgtcg
ccgaagatcgtgcagacgcacgtgcgccacatcctgctgcgcgtcggcgaaggcaagtcg
gaatcgcaggcgcgccagcaactgatcgacatccgccggcagatcgaatcgggcggcgat
ttcgagaagttcgcgcgcacctactcgcaggacggctcggcgtcgcaaggcggcgacctc
ggctggatcagccccggcgagacggtgcccgaattcgagcgtgcgatgaacacgctgcag
gacggccaggtcagcaacccggtgcgcaccgagtacggctaccacctgatccaggtgctc
ggccgccgcgacgcggaaggctcggtgcagcagcagatggacatcgcgcgtcaggcgatc
ggccagcgcaaggccgagcaggcgtattccgactggctgcgcgagctacgcgactcgtcg
tacgtgcagatcaagctgcccgtcgcccagtaa

DBGET integrated database retrieval system