KEGG   Burkholderia pseudomallei K96243: BPSL0937Help
Entry
BPSL0937          CDS       T00203                                 

Definition
(RefSeq) class II aldolase/adducin domain-containing protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps00051  Fructose and mannose metabolism
bps01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bps00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BPSL0937
Enzymes [BR:bps01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BPSL0937
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-GeneID: 3092851
NCBI-ProteinID: YP_107565
UniProt: Q63WF1
Position
1:complement(1088737..1089519)
Genome map
AA seq 260 aa AA seqDB search
MVDTLKMGKAELVALAQRRLDNEIKDSGWSAREKLALTCRILFDDGHDSGLAGQITCRAD
APHTYYTQRLGLGFDEIAESNLLQVDQDLEVIGGQGIPNPANRFHTWIYRARPDVNCIIH
THPTHVAALSMLETPLVVSHMDTCPLHGDCAFLKDWPGVPVGNEEGEIISNALGDKRAIL
LSHHGQLVVGKTIEEACMLAILIERAARLQLLAMAAGAIAPIPPALAADAHDWISTPKRD
AVTFAYYARRALRRHPDCLD
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacacattgaagatgggcaaggccgagctcgtcgcgctcgcgcagcggcggctc
gacaacgagatcaaggacagcgggtggagcgcgcgcgagaagctcgcgctcacctgccgg
atcctgttcgacgacgggcacgactccggcctcgccgggcagatcacgtgccgcgccgac
gcgccgcacacgtactacacgcagcgcctcgggctcggcttcgacgagatcgccgaatcg
aacctgctgcaggtcgatcaggacctcgaggtcatcggcggccagggcattccgaatccc
gcgaaccgctttcacacgtggatttatcgcgcgcgccccgacgtcaactgcatcatccac
acgcacccgacgcacgtcgccgcgctgtcgatgctcgagacgccgctcgtcgtgtcgcac
atggacacctgtccgcttcacggcgactgcgcgttcctgaaggattggccgggcgtgccc
gtcggcaacgaggaaggcgagatcatctcgaacgcgctcggcgacaagcgcgcgatcctg
ctgtcgcatcacggccagctcgtcgtcggcaagacgatcgaagaggcgtgcatgctcgcg
atcctgatcgagcgcgcggcgcggctgcaactgctcgcgatggcggccggcgcgatcgcg
ccgattccgcccgcgctcgcggccgacgcgcacgactggatctcgacgcccaagcgcgac
gcggtgaccttcgcgtactacgcgcgccgcgcgctacgccgccaccccgactgcctcgac
tga

DBGET integrated database retrieval system