KEGG   Burkholderia pseudomallei K96243: BPSL1006Help
Entry
BPSL1006          CDS       T00203                                 

Gene name
argH
Definition
(RefSeq) argininosuccinate lyase
  KO
K01755  argininosuccinate lyase [EC:4.3.2.1]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps00220  Arginine biosynthesis
bps00250  Alanine, aspartate and glutamate metabolism
bps01100  Metabolic pathways
bps01110  Biosynthesis of secondary metabolites
bps01130  Biosynthesis of antibiotics
bps01230  Biosynthesis of amino acids
Module
bps_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:bps00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BPSL1006 (argH)
   00220 Arginine biosynthesis
    BPSL1006 (argH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bps04147]
    BPSL1006 (argH)
Enzymes [BR:bps01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.1  argininosuccinate lyase
     BPSL1006 (argH)
Exosome [BR:bps04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BPSL1006 (argH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyase_1 ASL_C2
Motif
Other DBs
NCBI-GeneID: 3092554
NCBI-ProteinID: YP_107634
UniProt: Q63W82
Position
1:complement(1169883..1171292)
Genome map
AA seq 469 aa AA seqDB search
MTSQLHKKGEAWSARFSEPMSELVKRYTSSVFFDKRLALVDIAGSLAHAGMLAAQKIISA
DDLAAIERGMAQIKGEIERGEFEWQLDLEDVHLNIEARLTALIGDAGKRLHTGRSRNDQV
ATDIRLWLRGEIDRIGGLLNDLRGALIDLAEQNADTILPGFTHLQVAQPVTFGHHLLAYV
EMFSRDAERMRDCRARVNRLPLGAAALAGTSYPIDRHAVAKTLGFDGICANSLDAVSDRD
FAIEFTAAAALVMTHVSRFSEELVLWMSPRVGFIDIADRFCTGSSIMPQKKNPDVPELAR
GKTGRVNGHLMALLTLMKGQPLAYNKDNQEDKEPLFDTVDTVADTLRIFAEMVAGITVKP
DAMRAAALQGFSTATDLADYLVKRGLPFRDAHEAVAHAVKVCDARGIDLADLTLDEMKQE
LPNVAHLIGEDVFDYLTLEGSVASRNHPGGTAPDQVRAAAKAARAALGQ
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcccaactgcacaaaaagggcgaggcctggtcggcccgcttttcggaaccgatg
tccgagctcgtcaagcgctacacgtcgtcggtcttcttcgacaagcggctcgcgctcgtc
gacatcgccggctcgctcgcgcacgcgggcatgctcgccgcgcagaagatcatcagcgcc
gacgacctcgccgcgatcgagcgcgggatggcgcaaatcaagggcgagatcgagcgcggc
gaattcgaatggcagctcgatctcgaagacgtccacctgaacatcgaggcgcgcctgacc
gcgctcatcggcgatgcgggcaagcgcctgcacacgggccgctcgcgcaacgatcaggtc
gcgaccgacatccgcctgtggctgcgcggcgagatcgaccggatcggcggcctgctgaac
gacctgcgcggcgcgctgatcgatctcgccgaacagaacgcggacacgatcctgccgggc
ttcacgcacctgcaggtcgcgcagcctgtcacgttcggccatcacctgcttgcctacgtc
gagatgttctcgcgcgacgccgagcgcatgcgcgactgccgcgcgcgcgtgaaccgcctg
ccgctcggcgcggcggcgctcgcgggcaccagctatccgatcgaccgccacgcggtggcg
aagacgctcggcttcgacggcatctgcgcgaactcgctcgacgcggtgtccgatcgcgac
ttcgcgatcgaattcacggccgcggccgcgctcgtgatgacgcacgtgtcgcgcttctcg
gaagaactcgtgctgtggatgagcccgcgcgtgggcttcatcgacatcgccgaccgcttc
tgcaccggcagctcgatcatgccgcagaagaagaacccggacgtgcccgagctcgcgcgc
ggcaagacgggccgcgtaaacggccacctgatggcgctgctcacgctgatgaagggccag
ccgctcgcgtacaacaaggacaatcaggaagacaaggaaccgctgttcgacacggtcgac
accgtcgccgacacgctgcggatcttcgcggagatggtcgcgggcatcacggtgaagccg
gacgcgatgcgcgcggccgcgctgcagggcttctcgaccgcgacggatctcgcggactac
ctggtcaagcgcgggttgccgttccgcgacgcgcacgaggcggtcgcgcacgcggtgaag
gtctgcgacgcgcgcggcatcgacctcgcggatctgacgctcgacgaaatgaagcaggaa
ctgccgaacgtcgcgcatctgatcggcgaggacgtgttcgactatctgacgctcgaaggc
tcggtcgcgagccgcaatcatccgggcggcaccgcgccggaccaggtgcgcgcggcggcg
aaggccgcgcgcgcggcgctcggccagtag

DBGET integrated database retrieval system