KEGG   Burkholderia pseudomallei K96243: BPSL1012Help
Entry
BPSL1012          CDS       T00203                                 

Definition
(RefSeq) SAM-dependent methyltransferase
Organism
bps  Burkholderia pseudomallei K96243
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_31 Methyltransf_23 Ubie_methyltran Methyltransf_12 MTS PrmA Methyltransf_29 Methyltransf_8 PCMT Methyltransf_2 TehB CMAS Methyltransf_9 Methyltransf_4 Methyltransf_24 MetW Methyltransf_32 Methyltransf_18 DUF938 Cons_hypoth95 FtsJ Met_10
Motif
Other DBs
NCBI-GeneID: 3091472
NCBI-ProteinID: YP_107640
UniProt: Q63W76
Position
1:1178289..1179062
Genome map
AA seq 257 aa AA seqDB search
MARSTPMKHHDRVADAFGTTASAYLTSAVHATGADLDTFAAEIGATPGARVLDLGCGAGH
ASFAAARGGAHEVIAYDLAPQMLATVEAAARERGLSNVRIEQGAAERLPFADASFDWIVS
RMSAHHWHDVPRALAEARRVLKPGGRVLFVDVAGADHPLVDTHLQAVEVLRDASHVRDYR
VDEWLAFFAQAGFAARVRERWRLSIGFDGWVARMRTPDVRAHAIRALWADAPDEVRAYFD
VQPDGSFKLDVVMIDAR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggcaaggagcacgccgatgaagcatcacgaccgggtggccgacgcgttcggcacgacc
gcatccgcctatctgacgagcgccgttcatgcgacgggcgcggatctggacacgttcgcc
gcggagatcggcgcgacgccgggcgcgcgcgtgctggatctcggctgcggcgcgggccat
gcgagctttgccgccgcgcgcggcggcgcgcacgaggtgatcgcgtacgacctcgcgccg
cagatgctcgcgacggtcgaggcggcggcgcgcgagcgcggcctgtcgaacgtgcgaatc
gagcagggcgcggccgagcggctgccgttcgccgatgcgtcgttcgactggatcgtgagc
cggatgagcgcgcaccattggcacgacgtgccgcgcgcgctcgccgaagcgcggcgcgtg
ctgaagcctggcggccgggtgctgttcgtcgacgtcgccggcgccgatcacccgctcgtc
gacactcatctgcaggcggtcgaggtgttgcgcgacgcgtcgcacgtgcgtgattaccgc
gtggacgaatggctcgcgttcttcgcgcaggcggggttcgccgcgcgggtgcgggagcgc
tggcgcctgtcgatcgggttcgacggctgggtcgcgcggatgaggacacccgacgtgcgc
gcgcatgcgatccgcgcgctgtgggcggacgcgcccgacgaggtgcgcgcgtatttcgac
gtgcagccggacggctcgttcaagctcgatgtggtgatgatcgacgcgcggtga

DBGET integrated database retrieval system