KEGG   Burkholderia pseudomallei K96243: BPSL1020Help
Entry
BPSL1020          CDS       T00203                                 

Definition
(RefSeq) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps00010  Glycolysis / Gluconeogenesis
bps00053  Ascorbate and aldarate metabolism
bps00071  Fatty acid degradation
bps00280  Valine, leucine and isoleucine degradation
bps00310  Lysine degradation
bps00330  Arginine and proline metabolism
bps00340  Histidine metabolism
bps00380  Tryptophan metabolism
bps00410  beta-Alanine metabolism
bps00561  Glycerolipid metabolism
bps00620  Pyruvate metabolism
bps00625  Chloroalkane and chloroalkene degradation
bps00903  Limonene and pinene degradation
bps01100  Metabolic pathways
bps01110  Biosynthesis of secondary metabolites
bps01120  Microbial metabolism in diverse environments
bps01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BPSL1020
   00053 Ascorbate and aldarate metabolism
    BPSL1020
   00620 Pyruvate metabolism
    BPSL1020
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BPSL1020
   00561 Glycerolipid metabolism
    BPSL1020
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BPSL1020
   00310 Lysine degradation
    BPSL1020
   00330 Arginine and proline metabolism
    BPSL1020
   00340 Histidine metabolism
    BPSL1020
   00380 Tryptophan metabolism
    BPSL1020
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BPSL1020
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BPSL1020
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BPSL1020
Enzymes [BR:bps01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BPSL1020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LPD7 DUF1487
Motif
Other DBs
NCBI-GeneID: 3092105
NCBI-ProteinID: YP_107648
UniProt: Q63W68
Position
1:complement(1189316..1190755)
Genome map
AA seq 479 aa AA seqDB search
MEEAKHFIAGAWAPPAGGETIAVIDPSDGEPFARLARGTAPDVGAAVQAARAAFDGSWGA
LGAADRGRMLYRLSMLVAACREELALIESRDTGKPLTQARADADALARYLEFYAGAADKL
HGETLPYRDGYTVLTLREPHGVTGHIVPWNYPMQILGRSVGAALAAGNACVVKPSEDACL
SILRVATLAAEAGLPEGAFNVVTGYGHEAGAALARHPGVDHLSFTGSPDTGRLVAQMAAE
HHASVTLELGGKSPQIVFADADLDAALPVLVSAIVQNAGQTCSAGSRVLIDKAVYEPLVE
RLATAFNGLKVGPGRADLDCGPLINAKQQQRVWDFLSDAQHDGITMAAHGQVVPDAPETG
FYQAPALLRDVPHTHRLAQEEVFGPVLAAMPFADEDEALALANGTPFGLVAGIWTRDGAR
QMRLARKVRAGQVFVNNYGAGGGVELPFGGTGRSGYGREKGFEALYGFTVLKTIALRHG
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagcgaagcacttcatcgcgggcgcatgggcgccgcccgcgggcggcgagacg
atcgccgtgatcgacccgtccgacggcgagccgttcgcgcggctcgcgcgcggcaccgcg
cccgatgtcggcgcggccgtgcaagcggcgcgcgccgcgttcgacggctcgtggggcgcg
ctcggcgcggccgaccgcgggcgcatgctgtaccggctgtcgatgctcgtcgccgcgtgc
cgcgaggagctcgcgctcatcgaatcgcgcgacaccggcaagccgctcacgcaggcgcgc
gcggacgccgacgcgctcgcccgctacctcgagttctacgcgggcgcggccgacaagctg
cacggcgagacgctgccctaccgcgacggctacacggtactcacgctgcgcgagccgcac
ggcgtgacgggccacatcgtgccgtggaattatccgatgcagatcctcgggcgcagcgtc
ggcgcggcgctcgccgcgggcaacgcgtgcgtcgtcaagccctcggaggacgcgtgcctg
tcgatcctgcgcgtcgccacgctcgccgccgaagccgggctgcccgagggcgcgttcaac
gtcgtgacgggctacggccacgaagcgggcgcggcgctcgcgcgccatcccggcgtcgat
cacctgtcgttcaccggttcgccggatacaggccgcctcgtcgcgcagatggcggccgag
caccacgcgagcgtcacgctcgagctcggcggcaagtcgccgcagatcgtgttcgccgac
gcggatctcgacgcggcattgcccgtcctcgtgtccgcgatcgtccagaacgccggccag
acctgttcggccggcagccgcgtgctgatcgacaaggcggtctacgagccgctcgtcgag
cggctcgcgaccgcgttcaacgggctgaaggtcggccccggccgcgccgatctcgattgc
gggccgctcatcaacgcgaagcagcagcagcgcgtgtgggacttcctctccgatgcgcag
cacgacggcatcacgatggccgcgcacggccaggtcgtgccggacgcgcccgaaacgggc
ttctaccaggcgcccgcgctgcttcgcgacgtgccgcacacgcaccggctcgcacaggag
gaagtgttcgggccggtgctcgccgcgatgccgttcgccgacgaggacgaagcgctcgcg
ctcgcgaacggcacgccgttcgggctcgtcgccggcatctggacgcgcgacggcgcgcgg
cagatgcggctcgcacgcaaggtgcgcgcggggcaggtgttcgtcaacaactacggcgcg
ggcggcggcgtcgagttgccgttcggcggtaccgggcgctcgggctacggccgcgagaag
ggcttcgaggcgctgtacggcttcaccgtgctgaagacgatcgcgctgcggcacggctga

DBGET integrated database retrieval system