KEGG   Burkholderia pseudomallei K96243: BPSL1025Help
Entry
BPSL1025          CDS       T00203                                 

Definition
(RefSeq) hypothetical protein
  KO
K09919  uncharacterized protein
Organism
bps  Burkholderia pseudomallei K96243
Brite
KEGG Orthology (KO) [BR:bps00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BPSL1025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FemAB_like Acetyltransf_6 BfiI_DBD
Motif
Other DBs
NCBI-GeneID: 3094827
NCBI-ProteinID: YP_107651
UniProt: Q63W65
Position
1:complement(1193265..1194443)
Genome map
AA seq 392 aa AA seqDB search
MKHERRDYRMGILTSVLDASAAEWDALVARAPRPTPFLKHAFLSALHRAGCATDGTGWTP
RFVTLADSATDALVAAAPVYAKRHSYGEYVFDWAWADAYQRNGLPYYPKLLCAVPFTPVQ
GSRLLAVDDDSRRRLAATLVALAEQSDVSSLHVLFPTGDEARALADMGMMLREGVQFHWL
NDGYRDFDAFLGTLEQKKRKNIRAERRKVADAGVTLRRVRGEDATDADWRFFARCYRQTY
REHFSSPYLNLEFFREIGATMPENLLLVIAERDGRPIASALAVYQRGEAGGGTLYGRYWG
ALEHVPCLHFETAYYQLLEFCIEERLDTFEGGAQGEHKLARGFMPTVTHSAHWLAHPAFA
DAVGHFLAQETNQIHAYVDELREHNPFRAGER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacacgaacgtcgcgattatcgcatgggcatcctcacgtctgtcctcgacgcaagc
gccgccgagtgggacgcgctcgtcgcgcgcgcgccgcgcccgacgcccttcctgaagcac
gcgttcctgagcgcgctgcaccgcgccggctgcgcgaccgacggcaccggctggacgccg
cgcttcgtcacgctcgcggacagtgcgacggacgcgctcgtcgcggccgcgcccgtctat
gcgaagcgccattcgtatggcgaatacgtgttcgactgggcgtgggcggacgcgtaccag
cgcaacgggctgccgtactacccgaagctgctgtgcgcggtgccgttcacgcccgtgcag
ggcagccggctcctcgccgtcgacgacgactcgcgccgccggctcgccgcgacgctcgtc
gcgctcgccgagcagagcgacgtgtcgtcgctgcacgtgctgtttccgacgggcgacgag
gcgcgcgcgctcgccgacatggggatgatgctgcgcgagggcgtgcaattccactggctg
aacgacggctaccgcgacttcgacgcgttcctcggcacgctcgagcagaagaagcgcaag
aacatccgcgcggagcgccgcaaggtcgcggacgcgggcgtcacgctgcgccgcgtgcgc
ggcgaggacgcgaccgacgccgattggcgcttcttcgcgcgctgctaccggcagacgtac
cgcgagcacttctcgagcccgtatctgaatctcgaattcttccgcgagatcggcgcgacg
atgccggagaacctgctgctcgtgatcgccgagcgcgacgggcggccgatcgcgagcgcg
ctcgccgtctaccagcgcggcgaggcgggcggcggcacgctgtacggccgctactggggc
gcgctcgaacacgtgccgtgcctgcacttcgagaccgcgtactaccagttgctcgaattc
tgcatcgaagagcggctcgacacgttcgaaggcggcgcgcagggcgagcacaagctcgca
cgcggcttcatgccgaccgtcacgcattcggcgcactggctcgcgcatccggcgttcgcc
gacgcggtcgggcacttcctcgcgcaggagacgaaccagattcacgcgtacgtcgacgag
ctgcgcgagcacaatccgttcagggccggcgagcgctga

DBGET integrated database retrieval system