KEGG   Burkholderia pseudomallei K96243: BPSL1036Help
Entry
BPSL1036          CDS       T00203                                 

Definition
(RefSeq) two-component system response regulator
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps02020  Two-component system
Module
bps_M00445  EnvZ-OmpR (osmotic stress response) two-component regulatory system
bps_M00742  Aminoglycoside resistance, protease FtsH
bps_M00743  Aminoglycoside resistance, protease HtpX
Brite
KEGG Orthology (KO) [BR:bps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BPSL1036
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bps02022]
    BPSL1036
Two-component system [BR:bps02022]
 OmpR family
  EnvZ-OmpR (osmolarity) [MD:M00445]
   BPSL1036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C B12-binding FleQ
Motif
Other DBs
NCBI-GeneID: 3094647
NCBI-ProteinID: YP_107662
UniProt: Q63W54
Position
1:1205833..1206558
Genome map
AA seq 241 aa AA seqDB search
MTTQILIVDDDQELRDLLRDYLVRQGIEVSVLHDAASLEKRLERERPDLIVLDLMMPGVD
GLTALRQLRAAGDDIPVIMLTARADDVDRIVGLELGADDYLGKPFNPRELLARAQAVLRR
RRASPSAAAPEQREPYAFGRFVLDFQARTLSVDSKPATLSSSEFALLKIFVNHALRTLTR
ERLLELLHGPEYDGTDRGIDVQVWRLRRILETDPSTPRFIQTVRGRGYVFVPNGEAHAQT
H
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgactactcagatcctcatcgtcgacgacgaccaagaactgcgcgacctgctgcgcgac
tacctcgtgcggcaaggcatcgaagtgtcggtgctgcacgacgcggcctcgctcgagaag
cgcctcgagcgcgagcggcccgatctcatcgtgctggacctgatgatgccgggtgtcgac
ggcctcaccgcgctgcgccaactgcgcgcggcgggcgacgacattccggtgatcatgctg
accgcgcgcgcggacgacgtcgaccggatcgtcggcctcgagctcggcgcggacgactat
ctcggcaagccgttcaacccgcgcgagctgctcgcgcgcgcgcaggcggtgctgcgccgc
cgccgcgcgagcccgtcggcggcggcgcctgagcagcgcgagccgtacgcgttcggccgc
ttcgtgctcgacttccaggcgcgcacgctgtcggtcgacagcaagccggcgacgctgtcg
agcagcgagttcgcgctcctgaagatcttcgtcaaccatgcgctgcgcacgctgacccgc
gagcgcctgctcgagctgctgcacggccccgagtacgacggcaccgatcgcgggatcgac
gtgcaggtctggcgtctgcgccggatcctcgaaaccgatccgtcgacgccgcgcttcatc
cagacggtgcgcgggcgcggctacgtgttcgtgccgaacggcgaggctcatgcgcaaacc
cattga

DBGET integrated database retrieval system