KEGG   Burkholderia pseudomallei K96243: BPSL1038aHelp
Entry
BPSL1038a         CDS       T00203                                 

Definition
(RefSeq) hypothetical protein
Organism
bps  Burkholderia pseudomallei K96243
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 3093800
NCBI-ProteinID: YP_107665
UniProt: Q63W51
Position
1:complement(1208322..1208597)
Genome map
AA seq 91 aa AA seqDB search
MTASAAKPPRSPGSRRFAREAGSARPRDGTTLLHPVFQAQPCGRRTMEILPGRKRIGPAT
GGRRADQREVACAGWPLLRRNVELCRDPALP
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
ttgactgcaagtgccgcgaagccgccgcgctcccccgggagccggcgtttcgctcgcgaa
gcggggagcgcccggcctcgcgacggcacgacactactacatcctgtatttcaggcacaa
ccttgcggacgacgaacgatggaaatcctgcccggccgcaagcgcatcggccccgcaacg
ggcgggcggcgggcggatcaacgagaagtggcgtgcgccggctggccgctgctgcgccgc
aacgtcgaattatgccgcgatccggccctgccgtga

DBGET integrated database retrieval system