KEGG   Burkholderia pseudomallei K96243: BPSL1039Help
Entry
BPSL1039          CDS       T00203                                 

Definition
(RefSeq) ABC transporter permease
  KO
K02050  NitT/TauT family transport system permease protein
Organism
bps  Burkholderia pseudomallei K96243
Module
bps_M00188  NitT/TauT family transport system
Brite
KEGG Orthology (KO) [BR:bps00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bps02000]
    BPSL1039
Transporters [BR:bps02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   NitT/TauT family transporter [MD:M00188]
    BPSL1039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 HHH
Motif
Other DBs
NCBI-GeneID: 3091509
NCBI-ProteinID: YP_107666
UniProt: Q63W50
Position
1:1208692..1210449
Genome map
AA seq 585 aa AA seqDB search
MDLGFFDPNRTANASAWRVLPNRWDFVAFPLIICVIAMAAIGFHETMAPIATLETQRISL
DPANLPEYALRTTLRMLAAMVAALAFTLVYGTLAAKSRRAGMVLVPILDILQSVPVLGYI
SFTVTFFLALIPSRVLGAELAAIFAIFTSQAWNMTFSFYQSLRTVPRDLDEVSRGFHLTA
WQRFWKLEVPFSMPGLIWNMMMSMSGGWFFVVASEAITVGNHTITLPGIGAYLAQAIVEK
NLGAVGWVILAMTVVILAYDQLLFRPLVAWADKFRMETTSSGNAPESWLLDLVRRTRLIH
QLLVPAGWFFARLARIPLRVPSLDAVRFSMPRVEKKASRAADIAWAIAVIVGTVYVVWRV
FAYVSTGVTLAEVGHVFVLGLITLLRVALLIAIASLVWVPIGVWIGLRPAIAEKVQPLAQ
FLAAFPANLLFPVFVIVIARFHLNADIWLSPLIVLGTQWYILFNVIAGATAYPNDYREAA
TNFRIRGWQWWRQAILPGIFPYYVTGAITASGGAWNASIVSEFVQWGDTKIEAHGLGAYI
AQTTAAGDYPKIILGIAVMSLFVTLFNRLLWRPLYAYAEAKLRLD
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggatctcggattcttcgatccgaaccggaccgccaacgcatccgcgtggcgggtcctg
ccgaaccgctgggatttcgtcgcgtttccgctcatcatctgcgtgatcgcgatggcggcg
atcggctttcacgagacgatggcccccatcgcgacgctcgagacgcagaggatttcgctc
gatccggcgaacttgcccgaatacgcgctgcgcacgacgctgcgcatgctcgcggcgatg
gtcgccgcgctcgcgttcacgctcgtctacggcacgctcgccgcgaagagccgccgcgcg
gggatggtgctcgtgccgatcctcgacatcctgcagtcggtgcccgtgctcggctacatc
tcgtttacggtcacgttcttcctcgcgctgattccgagccgcgtgctcggcgccgagctc
gccgcgatcttcgcgatcttcacgagccaggcgtggaacatgacgttcagcttctaccag
tcgctgcgcacggtgccgcgcgatctcgacgaagtgtcgcgcggctttcacctgaccgcg
tggcagcgcttctggaagctcgaagtgccgttctcgatgccagggctcatctggaacatg
atgatgtcgatgtcgggcggctggttcttcgtcgtcgcgtccgaggcgatcacggtcggc
aaccacacgatcacgctgcccggcatcggcgcttatctcgcgcaggcgatcgtcgagaag
aacctcggcgcggtcggctgggtgattctcgcgatgacggtggtgattctcgcgtacgac
cagctcctgttccggccgctcgtcgcgtgggcggacaagttccggatggagacgacgagc
tcgggcaacgcgcccgaatcgtggctgctcgacctcgtgcgccgcacgcgcctcatccac
cagttgctcgtgccggcgggctggttcttcgcgcggctcgcgcggattccgctgcgcgtg
ccgtcgctcgacgcggtccgcttctcgatgccgcgcgtcgagaagaaggcgtcgcgcgca
gccgacatcgcatgggcgatcgccgtgatcgtcggcacggtctatgtcgtgtggcgcgtg
ttcgcatacgtgagcacgggcgtgacgcttgccgaggtcggccatgtgttcgtgctcggg
ctcatcacgctgctgcgcgtcgcgctcctgatcgcgatcgcctcgctcgtgtgggtgccg
atcggcgtgtggatcggcctgcggcccgcgatcgccgagaaggtgcagccgctcgcgcag
ttcctcgcggcgttcccggcgaacctgctgttcccggtgttcgtgatcgtgatcgcgcgc
tttcacctgaacgccgacatctggctgtcgcctctcatcgtgctcggcacccagtggtat
atcctgttcaacgtgatcgcgggcgcgaccgcctatccgaacgactatcgcgaagcggcc
accaatttccgcatccgcggctggcaatggtggcggcaggcgatcctgcccggcatcttc
ccgtactacgtgacgggcgcgatcaccgcgtcgggcggcgcgtggaacgcgagcatcgtg
tcggagttcgttcagtggggcgacaccaagatcgaggcgcacggcctcggcgcgtacatc
gcgcagacgacggccgcgggcgactacccgaagatcatcctgggcatcgccgtgatgtcc
ctgttcgtcaccttgttcaaccgcctgttgtggcgtccgctgtatgcgtacgccgaagcg
aagctgcgtctcgattga

DBGET integrated database retrieval system