KEGG   Burkholderia pseudomallei K96243: BPSL1040Help
Entry
BPSL1040          CDS       T00203                                 

Definition
(RefSeq) ABC transporter ATP-binding protein
  KO
K02049  NitT/TauT family transport system ATP-binding protein
Organism
bps  Burkholderia pseudomallei K96243
Module
bps_M00188  NitT/TauT family transport system
Brite
KEGG Orthology (KO) [BR:bps00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bps02000]
    BPSL1040
Transporters [BR:bps02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   NitT/TauT family transporter [MD:M00188]
    BPSL1040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_assoc_C ABC_tran AAA_21 AAA_29 AAA_30 AAA_16 RsgA_GTPase MMR_HSR1 NACHT
Motif
Other DBs
NCBI-GeneID: 3091510
NCBI-ProteinID: YP_107667
UniProt: Q63W49
Position
1:1210503..1211843
Genome map
AA seq 446 aa AA seqDB search
MQNPNAVNAPVQTPPAPPRVGEEILRVENVSRGFNKTQGELLVLDGANLSLREGEIVGLL
GRSGSGKSTLLRIIAGLIEPTGGEVTYLGKPLSGPAEGVAMVFQTFALFPWLTVLQNVEA
GLEALGVGARERRERALAAIDLIGLDGFENAYPRELSGGMRQRVGFARALVVDPTLLLMD
EPFSALDVLTAETLRTDLLDLWTQGRMPIKSVLIVTHNIEEAVFMCDRILVLSSNPGRVI
AEIKVPFKHPRNRLDPAFRRLVDDIYAKMTARQVGEATKKGLELGSWLPQVSTNLMAGLI
ETLAAPPYHGRADMPEIARTLHLEVDDLFPIAEVLQYLGFADVREGDVFLTPPGRVFAEF
GTQERKMMFAEHLLRHVPLAARIKKVLNERPGHRAPRVRFEQELEDFLSDGAAEETLDAV
IDWGRYGEIFSYNDQTEIFSLEDVES
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacccgaatgctgtcaacgcccccgtccagacgccgcccgcgccgccgcgggtc
ggcgaggaaatcctgcgcgtcgagaacgtgagccgcggcttcaacaagacgcagggcgag
ctgctcgtgctcgacggcgcgaacctgtcgctgcgcgaaggcgagatcgtcgggctgctc
ggccgctcgggctccggcaagtcgacgctcctgcggatcatcgccgggctgatcgagccg
acgggcggcgaggtcacgtatctcggcaagccgctgtccggcccggccgaaggcgtcgcg
atggtgttccagaccttcgcgctgtttccgtggctcaccgtgctgcagaacgtcgaggcg
gggctcgaggcgctcggcgtcggcgcgcgcgagcggcgcgagcgcgcgctcgccgcgatc
gacctgatcggcctcgacggcttcgagaacgcgtacccgcgcgagctgtcgggcggcatg
cgccagcgcgtgggcttcgcgcgcgcgctcgtcgtcgatccgacgctgctcctgatggac
gagccgttctccgcgctcgacgtgctgacggccgagacgctgcgcaccgatctgctcgat
ctgtggacgcagggccggatgccgatcaagtcggtgctgatcgtcacgcacaacatcgag
gaagcggtgttcatgtgcgaccggattctcgtgctgtcgtcgaatccgggccgcgtgatc
gcggagatcaaggtgccgttcaagcatccgcgcaaccggctcgacccggcgttccggcgc
ctcgtcgacgacatctacgcgaagatgaccgcgcgccaggtcggcgaggcgacgaagaag
gggctcgagctcggcagctggctgccgcaggtgtcgacgaacctgatggcgggtctcatc
gagacgctcgccgcgccgccgtaccacggccgcgcggacatgcccgagatcgcccgcacg
ctgcacctcgaggtcgacgatctgttcccgatcgccgaagtgctgcagtacctgggcttc
gccgacgtgcgcgagggcgacgtgttcctgacgccgccggggcgcgtgttcgccgaattc
ggcacgcaggagcgcaagatgatgttcgccgagcatctgctgcgccacgtgccgctcgcc
gcgcggatcaagaaagtgctgaacgagcggcccgggcatcgcgcgccgcgcgtgcgcttc
gagcaggagctcgaggatttcctgtcggacggcgcggctgaggagacgctcgacgcggtg
atcgactggggccgttacggcgagatcttctcgtacaacgaccagaccgagatcttcagt
ctcgaggacgtcgagtcctga

DBGET integrated database retrieval system