KEGG   Burkholderia pseudomallei K96243: BPSL1044Help
Entry
BPSL1044          CDS       T00203                                 

Gene name
otsA
Definition
(RefSeq) alpha,alpha-trehalose-phosphate synthase
  KO
K00697  trehalose 6-phosphate synthase [EC:2.4.1.15 2.4.1.347]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps00500  Starch and sucrose metabolism
bps01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bps00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BPSL1044 (otsA)
Enzymes [BR:bps01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.15  alpha,alpha-trehalose-phosphate synthase (UDP-forming)
     BPSL1044 (otsA)
    2.4.1.347  alpha,alpha-trehalose-phosphate synthase (ADP-forming)
     BPSL1044 (otsA)
Glycosyltransferases [BR:bps01003]
 Others
  Trehalose
   BPSL1044 (otsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_transf_20
Motif
Other DBs
NCBI-GeneID: 3092835
NCBI-ProteinID: YP_107671
UniProt: Q63W45
Position
1:1213901..1215319
Genome map
AA seq 472 aa AA seqDB search
MSRLIVVSNRVAAGQDARPTAGGLAVGVLDALKETGGVWFGWNGEIAGAPEEPVIERDGN
VTYATVGLTRRDYDQYYRGFSNATLWPVFHYRGDLARFDRQEYAGYLRVNCALAKQLCAL
VQPDDIIWVHDYHLLPFAHCLRELGVKNPIGFFLHIPFPSPEVLRTVPPHEELMKFMCAY
DVIGLQTESDKQAFVDYIERRGLGTSSEDGILHAHGRVVKVAAYPIGIYPDAIGKAAIEY
GSRKAVKALRDTMRERKLVISVDRLDYSKGLVERFQAFERMLANAPGWQGRVSLVQIAPP
TRSDVQTYQRIRQTLEGEAGRINGRFAQLDWTPIQYLNRKYERNLLMALFRLSQVGYVTP
LRDGMNLVAKEYVASQDPNDPGVLVLSEFAGAAAELPGALLVNPFDLSQMAESLERALAM
PLEERQARHAENIARLRKNDLSVWRDSFLTDLRSVATAASVTQRAGRRVANA
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgagcagattgatcgtggtatcgaatcgcgtggcggccggccaggatgcgcgtccgacg
gcgggcgggctggcggtcggcgtgctcgacgcgttgaaggagacgggcggcgtctggttc
ggctggaacggcgagatcgccggcgcgcccgaggagcccgtgatcgagcgggacggcaac
gtgacctatgcgaccgtcggcctgacccgccgcgactacgaccagtactatcgcggcttc
tcgaatgccacgctgtggccggtatttcactatcgcggcgatctcgcgcgcttcgatcgc
caggaatatgccggctatctgcgcgtgaactgcgcgctcgcgaagcagttgtgcgcgctc
gtgcagcccgacgacatcatctgggtgcacgactatcacctgctgccgttcgcgcactgc
ctgcgcgagctcggcgtgaagaacccgatcggcttcttcctgcacattcccttcccgtcg
cccgaggtgctgcggaccgtgccgccgcatgaagagctgatgaagttcatgtgcgcgtac
gacgtcatcggcctgcagaccgaaagcgacaagcaggcgttcgtcgattacatcgagcgg
cgcgggctcggcacgtcgagcgaggacgggatcctgcacgcgcacggccgcgtcgtgaag
gtcgccgcgtatccgatcggcatctatccggacgcgatcggcaaggcggcgatcgaatac
ggctcgcgcaaggcggtgaaggcgctgcgcgacacgatgcgcgagcgcaagctcgtgatc
agcgtggatcgcctcgattactcgaagggcctcgtcgagcgcttccaggcgttcgagcgg
atgctcgcgaatgcgccgggctggcaggggcgcgtgtcgctcgtgcagatcgcgccgccg
acccgctccgacgtgcagacctatcagcgcatccgtcagaccctcgaaggcgaggcgggg
cgcatcaacgggcgcttcgcgcagctcgactggacgccgatccagtacctgaaccgcaaa
tacgagcgcaatctgctgatggcgctgttcaggctgtcgcaggtgggctatgtgacgccg
ctgcgcgacgggatgaacctcgtcgcgaaggagtacgtcgcgtcgcaggatccgaacgat
ccgggcgtgctcgtgctctccgagttcgcgggcgccgcggccgagctgccgggcgcgctg
ctcgtgaacccgttcgatctgtcgcagatggccgaatcgctcgagcgcgcgctcgcgatg
ccgctcgaggagcggcaggcgcggcacgcggagaacatcgcgcggctgcgcaagaacgat
ctgtcggtgtggcgcgattcgttcctcacggatctgcgcagcgtcgcgacggccgcgtcc
gtcacgcagcgcgccggacggcgcgtcgcgaatgcctga

DBGET integrated database retrieval system