KEGG   Burkholderia pseudomallei K96243: BPSL1047Help
Entry
BPSL1047          CDS       T00203                                 

Definition
(RefSeq) hypothetical protein
Organism
bps  Burkholderia pseudomallei K96243
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 3093345
NCBI-ProteinID: YP_107674
UniProt: Q63W42
Position
1:1217068..1217325
Genome map
AA seq 85 aa AA seqDB search
MKAYAGRIAAVEVDGSGEMRACAVCWPVRFGDPWEAVGGRACDRSCIGERAEPGRCRGEP
HAGRARVGASVPNPVRAAPAGPSRG
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggcgtatgcgggacggatcgcggccgtcgaggtggacgggtcgggcgagatgcgg
gcgtgtgcggtgtgctggccggtgcgcttcggcgatccgtgggaggccgtcgggggcagg
gcgtgcgatcgctcatgcatcggtgagcgtgcggagccgggtaggtgcagaggagagccg
cacgcggggcgagcccgggtgggggcaagcgtgcccaatcccgtccgggcagccccggcc
ggccccagccggggctaa

DBGET integrated database retrieval system