KEGG   Burkholderia pseudomallei K96243: BPSL1048Help
Entry
BPSL1048          CDS       T00203                                 

Definition
(RefSeq) multidrug MFS transporter
  KO
K08169  MFS transporter, DHA2 family, multidrug resistance protein
Organism
bps  Burkholderia pseudomallei K96243
Brite
KEGG Orthology (KO) [BR:bps00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bps02000]
    BPSL1048
Transporters [BR:bps02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-2 (14 spanner) (DHA2) family [TC:2.A.1.3]
    BPSL1048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr LacY_symp
Motif
Other DBs
NCBI-GeneID: 3094165
NCBI-ProteinID: YP_107675
UniProt: Q63W41
Position
1:complement(1217526..1218953)
Genome map
AA seq 475 aa AA seqDB search
MRAQRTRRPASRLATASAMNADSGLPFPQRYWAIVCVALGITLAVLDGAIANVALPTIAR
DLRASDAASIWIVNAYQLAVTISLLPLASLGDRIGYRRVYIAGLMLFTAASLGCALSGTL
PALATLRVIQGFGAAGIMSVNTALVRMIYPSSQLGRGVAINAMVVALSSAVGPTVASAVL
AVAPWPWLFAINVPIGVAAVCGSLRALPANPGRSAPYDFIGAVMNACVFGLLIVSVDGLG
HGGNRASVALTALVAAVIGYFFVKRQLTQPAPLLPVDLMRVPIFALSIGTSVASFTSQML
AFVALPFWLQNTLGFSQVQTGLYMTPWPLVIVVAAPLAGVLSDRYSAGALGGIGLALFAS
GLFALATIGAHPTPVDIVWRMALCGAGFGLFQSPNNRAILSSAPRERAGGASGMLGTARL
TGQTLGAALVALIFGIAPQHGPTIALYAASSFAAVAAAVSLLRIRARRDTTAAAG
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtgcgcaacggactcgccgcccagcttctcgcctcgccaccgcctccgccatgaac
gccgactccggactgccgttcccgcaacgctactgggcgatcgtctgcgtcgcgctgggc
atcacgctcgccgtgctcgacggcgcgatcgcgaacgtcgcgctgccgacgatcgcccgc
gatctgcgcgcctccgacgccgcgtcgatctggatcgtcaacgcgtaccaactcgccgtc
acgatctcgctgctgccgctcgcctcgctcggggaccgcatcggctaccggcgcgtctac
atcgcggggctcatgctcttcacggcggcgtcgctcggctgcgcgctgtcgggcacgctg
cccgcgctcgcgacgctgcgcgtgatccagggcttcggcgcggccggcatcatgagcgtg
aataccgcgctcgtgcggatgatctatccgtcttcgcaactcgggcgcggcgtcgcgatc
aacgcaatggtcgtcgcactgtcgtcggcggtcgggccgaccgtcgcgtccgcggtgctc
gccgtcgcgccgtggccgtggctcttcgcgatcaacgtgccgatcggcgtcgccgccgtg
tgcggcagcctgcgcgcgctgccggcgaatccgggccgcagcgcgccgtacgatttcatc
ggcgccgtgatgaacgcctgcgtgttcgggctgttgatcgtgtccgtcgacgggctcggc
cacggcgggaatcgcgcgagcgtcgcgctcaccgcgctcgtggccgccgtgatcggctac
ttcttcgtcaagcgccagttgacgcagcccgcgccgctgttgcccgtcgacctgatgcgc
gttccgatcttcgcgctgtcgatcggcacatcggtcgcgtcgttcacatcgcagatgctc
gcgttcgtcgcgctgccgttctggctacagaacacgctcggcttctcgcaggtccagacg
gggctctacatgacgccgtggccgctcgtgatcgtcgtcgcggcgccgctcgcgggcgtg
ctgtccgaccgctattcggcgggcgcgctgggcggcatcggcctcgccctgttcgcatcc
ggcctgttcgcgctcgcgacgatcggtgcgcacccgacgcccgtcgacatcgtgtggcgg
atggcgctgtgcggcgcgggcttcgggctcttccagtcgccgaacaaccgcgcgatcctg
tcgtccgcgccgcgcgagcgcgcgggcggcgcaagcgggatgctcggcaccgcccggctc
accggacaaacgctcggcgccgcgctcgtcgcgctgatcttcggcatcgcgccgcagcac
gggccgacgatcgcgctctacgcggcgagctcgttcgccgccgtcgcggcggccgtgagc
ctgctgagaatccgcgcgcggcgcgatacgaccgccgcggcgggttga

DBGET integrated database retrieval system