KEGG   Burkholderia pseudomallei K96243: BPSL1054Help
Entry
BPSL1054          CDS       T00203                                 

Gene name
eco
Definition
(RefSeq) ecotin
  KO
K08276  ecotin
Organism
bps  Burkholderia pseudomallei K96243
Brite
KEGG Orthology (KO) [BR:bps00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    BPSL1054 (eco)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ecotin Papo_T_antigen
Motif
Other DBs
NCBI-GeneID: 3094320
NCBI-ProteinID: YP_107679
UniProt: Q63W37
Position
1:1222077..1222616
Genome map
AA seq 179 aa AA seqDB search
MKLASRLAAWAAYAAFAGYSAVAAAASASTPAAGADAASSPKPAVEDIKMFPAAQAGQKR
EVIVLPAEKLEEDIRVELVVGRTIKVDCNQHWFGGDLKHETVQGWGYPYYVLTDAKGPAA
TLMACPGQESQQAFVPVRGSGYLLRYNSRLPIVVYVPKEFEVRYRLWYGSNEVARAVEK
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagcctctcgcttggcagcctgggcggcgtatgccgcattcgccggctattcc
gccgtcgcggcggcggcgagcgcgtcgacgcccgccgcgggcgccgatgccgcgtcgtcg
ccgaagccggccgtggaagacatcaagatgttcccggccgcccaggcggggcagaagcgc
gaggtcatcgtgctgcccgccgaaaagctggaagaagacattcgcgtcgaactcgtcgtc
ggcaggacgatcaaggtcgattgcaatcagcactggttcggcggcgatctcaagcatgaa
acggtgcagggctggggctatccgtactacgtgctcaccgacgcgaaggggccggccgcc
acgctgatggcctgcccgggccaggaatcgcagcaggcgttcgtgccggtgcgcggcagc
ggctacctgttgcgctacaacagccgcctgccgatcgtcgtgtacgtgccgaaggagttc
gaggttcgctaccggttgtggtacgggtcgaacgaagtggcgcgcgcggtcgagaagtaa

DBGET integrated database retrieval system