KEGG   Burkholderia pseudomallei K96243: BPSL1067Help
Entry
BPSL1067          CDS       T00203                                 

Definition
(RefSeq) hypothetical protein
Organism
bps  Burkholderia pseudomallei K96243
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4399 BiPBP_C
Motif
Other DBs
NCBI-GeneID: 3093117
NCBI-ProteinID: YP_107690
UniProt: Q63W26
Position
1:1232690..1233145
Genome map
AA seq 151 aa AA seqDB search
MRGVSFDGLSTQKERAMLYNKWLAGAFTAAALFASASAHAEARVYFVEPADGASVSSPVH
VKFGLEGDIVLRPAGDMTPHTGHHHLLIDGKPVARGDVIPANDHSLHFGKPQTETEVRLS
PGRHTLTLQFGDGAHRSYGPEMSQTITVNVK
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcggtgtatccttcgatggcctttcaacccaaaaggagagagcaatgctctacaac
aagtggctggccggcgcattcaccgcggccgcgctcttcgcgtccgcctcggcgcacgcg
gaagcgagggtgtatttcgtcgagccggccgacggcgcgtccgtctcgagccccgttcac
gtgaaattcggtctcgaaggcgacatcgtgcttcggcccgcgggcgacatgacgccccac
accggtcaccaccacctgctgatcgacggcaagccggtggccagaggcgacgtgattccc
gccaacgatcactcgctgcatttcggcaagcctcagaccgagacggaggtgaggctgtcg
cccggtcggcacacgctgacgctgcagttcggcgatggcgcgcaccgctcgtacggcccg
gagatgagccagaccatcacggtcaacgtcaagtag

DBGET integrated database retrieval system