KEGG   Burkholderia pseudomallei K96243: BPSL1068Help
Entry
BPSL1068          CDS       T00203                                 

Definition
(RefSeq) ABC transporter ATP-binding protein
  KO
K15738  ABC transport system ATP-binding/permease protein
Organism
bps  Burkholderia pseudomallei K96243
Brite
KEGG Orthology (KO) [BR:bps00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bps02000]
    BPSL1068
Transporters [BR:bps02000]
 ABC Transporters, Eukaryotic Type
  Other subfamilies
   Other ABC transporters
    BPSL1068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 ABC_tran_CTD ABC_tran_Xtn SMC_N AAA_16 AAA_22 AAA_29 MMR_HSR1 RsgA_GTPase NACHT AAA AAA_15 AAA_30 AAA_23 TsaE Zeta_toxin AAA_33 cobW MobB
Motif
Other DBs
NCBI-GeneID: 3093263
NCBI-ProteinID: YP_107691
UniProt: Q63W25
Position
1:1233313..1235259
Genome map
AA seq 648 aa AA seqDB search
MSLYSITGAQLAFGHVALLDHADFSLEAGERVGLIGRNGAGKSSLLKIVADLAKPDDGLV
TRQQHLVTVYVPQEPEFAAGQTVFDAVASGLTDTRALLAEYDEIAHRLADTPEGAEHDAL
LARMNALQSSLDATDAWNWRTRVATTLAQIGLDGDTKIDALSGGMQKRAALARALVVQPD
VLLLDEPTNHLDFDGIRWLEELLVAQRAGLFFITHDRAFLDRVATRIVELDRGRLLSYPG
NFSAYQTRKAQQLEVERVENEKFDKLLAQEEVWIRKGVEARRTRSVGRVARLEQMRRERA
ERRNAQGNVRLDVAQGEKSGKIVAELTDVTKRYGERTVVERFSATVMRGDKIGFVGPNGA
GKTTLLKLILGELKPDAGTVRTGTNLQVAYFDQMRAQLDQEKSLADTISPGSEWVEIGGV
RKHVMSYLGDFLFAPERARSPVKSLSGGERNRLLLARLFARPANVLVLDEPTNDLDIPTL
ELLEELLTDYDGTVLLVSHDRAFLDNVVTSVIASEGNGLWREYVGGFTDWQIQRERAQRI
AHEEAAKRAAKEPASAKDDAPKGAAGRNAQRTVKLSFNEQRELDALPARIAALEAEQKAI
AAQLEDGSIFSRDPQEGTRLTERFAALDDELLAALERWEALEAKRKPS
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctttattccattaccggcgcgcaactcgcgttcggccacgtcgcgctgctcgat
cacgcggacttctcgctcgaagccggcgagcgcgtcgggctcatcggccgcaacggcgcc
ggcaagtcgtcgctgctgaagatcgtcgcggatctggcgaaacccgacgacggcctcgtc
acgcggcagcagcacctcgtgacggtctatgtgccgcaggagccggaattcgccgccggg
cagacggtgttcgacgcggtggcctccgggctgaccgatacgcgcgcgctgctcgccgaa
tacgacgagatcgcgcaccggctcgccgatacgcccgagggcgccgagcacgacgcgctg
cttgcgcggatgaacgcgctgcaatcgtcgctcgacgcgacggacgcgtggaactggcgc
acgcgggtggcgacgacgctcgcgcagatcgggctcgacggcgatacgaagatcgacgcg
ctgtcgggcgggatgcagaagcgcgccgcgctcgcgcgcgcgctcgtcgtgcagccggac
gtgctgctcctcgacgagccgaccaaccatctcgatttcgacggcattcgctggctcgag
gaactgctcgtcgcgcagcgcgcgggcctgttcttcatcacgcacgatcgcgcgtttctc
gatcgcgtcgcgacgcgcatcgtcgagctcgaccgcggccgcctgctgtcgtatccgggc
aacttctccgcgtatcagacgcgcaaggcgcagcagctcgaggtcgagcgcgtcgagaac
gagaagttcgacaagctgctcgcgcaggaggaggtgtggatccgcaagggcgtcgaggcg
cggcgcacgcgcagcgtcggccgcgtcgcgcggctcgagcagatgcgccgcgagcgcgcg
gagcgccgcaacgcgcaaggcaacgtgaggctcgacgtcgcgcagggcgagaaatcgggc
aagatcgtcgcggagctgaccgacgtgacgaagcgctacggcgagcgcacggtcgtcgag
cgcttctcggccacggtgatgcgcggcgacaagatcggcttcgtcggcccgaacggcgcg
ggcaagaccacgctgctcaagctgatcctcggcgaactgaagcccgacgcgggcacggtg
cgcacgggcacgaacctgcaggtcgcgtatttcgaccagatgcgcgcgcaactcgatcag
gagaagagcctcgcggacacgatcagccccggcagcgagtgggtcgagatcggcggcgtg
cgcaagcacgtgatgagctatctgggcgacttcctgttcgcgcccgagcgcgcgcgctcg
cccgtcaagtcgctgtcgggcggcgagcgcaaccggctgctgctcgcgcgcctgttcgcg
cgcccggccaacgtgctcgtgctcgacgagccgaccaacgacctcgacatcccgacgctc
gaactgctcgaagagctgctgaccgattacgacggcacggtgctgctcgtcagccacgat
cgtgcgtttctcgacaacgtcgtcacgtcggtgatcgcctcggagggcaacggcctgtgg
cgcgaatacgtcggcggcttcaccgattggcagatccagcgcgagcgcgcgcagcggatc
gcgcacgaggaggcggccaagcgcgcggcgaaggagcccgcgagcgcgaaggacgacgcg
cccaagggcgcggcgggccgcaatgcgcagcgcacggtcaagctgtcgttcaacgagcag
cgcgagctcgacgcgctgcccgcgaggatcgcggcgctcgaggccgagcagaaggcgatt
gccgcgcagctcgaggacggctcgatcttctcgagggatccgcaggagggcacgcgcctg
accgagcgcttcgcggcgctcgacgacgagctgctcgcggcgctggagcgctgggaggcg
ctcgaggcgaaacgtaagccttcatga

DBGET integrated database retrieval system