KEGG   Burkholderia pseudomallei K96243: BPSL1071Help
Entry
BPSL1071          CDS       T00203                                 

Definition
(RefSeq) hypothetical protein
Organism
bps  Burkholderia pseudomallei K96243
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CopD DUF4149 DUF1772 DUF2214
Motif
Other DBs
NCBI-GeneID: 3093264
NCBI-ProteinID: YP_107694
UniProt: Q63W22
Position
1:1240517..1240975
Genome map
AA seq 152 aa AA seqDB search
MSHAIAVALFLHLLAVAVWVGGMVFANFCLRPALSDLSPQLRLPLVEAVFGRFFNWVAGA
VIVILLTGGFLLVKFGGAQATWPLHAMAGLGVVMMLIYGHIRFALFPRIRRAVQAQNWPD
GARAVNAVRLLVMVNLVLGVVTIGAAVLSRGF
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgtcccacgcaatcgccgttgccttgtttctccatctgctggcggtcgccgtctgggtg
ggcggcatggtgttcgcgaacttctgcctgcgccccgcgctgtcggacctgtcgccgcaa
ttgcgcctgccgctcgtcgaggccgtgttcggtcgcttcttcaactgggtcgcgggcgcg
gtgatcgtgatcctgctcacgggcgggttcctcctcgtgaaattcggcggcgcgcaggcg
acctggccgctgcatgcgatggccgggctcggcgtcgtgatgatgctgatctacgggcat
atccgcttcgcgctgtttccgcgcatccgccgcgcggtgcaggcgcagaactggccggac
ggcgcgcgtgcggtcaacgcggtgcgcctgctcgtgatggtcaatctcgtgctgggcgtc
gtgacgatcggggcggccgtgctgtcgcgcggcttctga

DBGET integrated database retrieval system