KEGG   Burkholderia pseudomallei K96243: BPSL1072Help
Entry
BPSL1072          CDS       T00203                                 

Definition
(RefSeq) LysR family transcriptional regulator
Organism
bps  Burkholderia pseudomallei K96243
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1
Motif
Other DBs
NCBI-GeneID: 3093453
NCBI-ProteinID: YP_107695
UniProt: Q63W21
Position
1:complement(1241121..1242005)
Genome map
AA seq 294 aa AA seqDB search
MRHSPEALLAFAEAANLGSFSAAARKLGKRQSTVSEAIANLEIDLGVTLFDRSTRQPTLT
DAARALLPEVQRVLEASEAIDQVAARLAGGEEARLTLVVSDTYQSSRYEETLAALDRRFP
TLEFECQIAEHDDVLDLIQQGRAQLGLMAARSTYPPDIGAATIAERSEIGLYVGPQHALA
AYGDAEVPLAALHDTRELRLNTYVAPRGERVETGLVAGRRCWLAPSYLQLLEMAVAGFGW
AELPRWMVEHFARERLVELNARGWPRRVPVDAVWSRGQPLGPAGSWLLETMLAA
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgcgccactctccggaagcgctgctcgcgttcgccgaggccgcgaacctcggctcgttc
tcggccgccgcgcgcaagctcggcaagcggcaatcgacggtcagcgaggcgatcgcgaac
ctcgagatcgatcttggcgtcacgctgttcgaccgctcgactcgccagccgacactgacc
gacgccgcccgtgcgctgctgcccgaagtccagcgcgtcctggaggcgagcgaggcgatc
gatcaggtcgccgcgcgtctggcgggcggcgaggaagcgcgcctcacgctcgtcgtgtcg
gatacctatcagtcgagccgatacgaggaaacgctcgcggcgctggaccgccgttttccg
acgctcgaattcgaatgccagatcgccgagcacgacgacgtgctcgacctgatccagcaa
ggccgcgcgcagctcgggctgatggcggcgcgcagcacctacccgcccgacatcggcgcg
gcgacgatcgccgagcgctcggagatcgggctgtacgtcggcccgcagcacgcgctcgcc
gcgtacggcgatgccgaggtgccgctcgccgcgctgcacgacacgcgcgagctgcgcctg
aacacctacgtcgcgccgcgcggcgagcgggtcgaaacggggctcgtcgcgggccggcgc
tgctggctggcgccgagctatctgcagttgctggaaatggcggtggcaggcttcggctgg
gcggagctgccgcgctggatggtcgagcacttcgcccgcgaacggctcgtcgagcttaat
gcgcgcggctggccgcggcgcgtgccggtggatgctgtgtggtcgcgcgggcagccgctc
gggccggccggctcatggctgctggagacgatgctcgccgcgtga

DBGET integrated database retrieval system