KEGG   Burkholderia pseudomallei K96243: BPSL1080Help
Entry
BPSL1080          CDS       T00203                                 

Definition
(RefSeq) hypothetical protein
Organism
bps  Burkholderia pseudomallei K96243
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EAL GGDEF dCache_1 DUF294_C Hom_end
Motif
Other DBs
NCBI-GeneID: 3093558
NCBI-ProteinID: YP_107702
UniProt: Q63W14
Position
1:complement(1249558..1251918)
Genome map
AA seq 786 aa AA seqDB search
MSSSRSHAARAARPVRATRKSRRRRALFAIPLLGTLALALLWVAIIARLSVEKDSAFRDA
GASAAILSTALEQHTVKAIHQVDQITRFVKYEFEKSPTRFNLASTVEKGVVPSDTLIQVS
ILDARGRLVANTAEAHPKPIDLSDREHFKVHMQRNDDDLYISKPVFGRVSRHWTLQMTRR
LNHPDGSFAGVVVVSEDPAYFTNDFYNNATLGKDGVIAVISDTGAVLARSTGSTQKTPGT
FSASGVYPVSERASGTYVDPIDGIVRIVSYRHLDGYPLGVMVGLSQAEEFADYHHTRNVY
LLMTGFITLAMLAFFGVATGLIGKLLGREREMTQLAEFDLLTGLANRYATLRSLRNDVAL
PSNLSRLAILFIDLDNFKTVNDTLGHNAGDIVLQMTAARLSDAVANEGALARIGGDEFVV
VVKGENVERRAERLAEAIVRMFAEPFDVRGSSFVLHASIGIALHSVENESEIDLLKKADL
AMYSAKDAGKNCYQFYAPHLSHRADHLMRWEQQLRVALSDGQLFLAYQPKIDLTYRCITG
FEALVRWDHPEHGVISANEFISIAESTGLIVPIGDFVIRTACEQLARWRNEGHDKLTLAV
NISPVQFWRGDLIDTISRALAETGIEARRLELEITETAMMEYPELVSEKIVALKRLGIRV
ALDDFGTGYSSLSYLHRFAVDTLKVDRSFIQAIPADRSVCVMVSSIVHLARSLGLTVVVE
GTETEEQIAWLAALGRIEAQGFLFSRPVPSDGIAALLARFGVCGGDSARAAGRDIANAAK
QSFGSD
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atgagttcgtctcggtcacacgccgcccgcgccgcgcggccggtgcgcgcgacacgcaag
tcgcgccgccgccgcgcgctgttcgcgattccgctcctcggcacgctggcgctcgcgctg
ctgtgggtggccatcatcgcgcgcctgtccgtcgagaaggacagcgcgttccgcgatgcg
ggcgcgtcggccgcgatcctgtcgacggcgctcgagcagcacacggtcaaggcgatccat
caggtcgaccagatcacccgcttcgtcaaatacgaattcgagaagtcgcccacccgcttc
aaccttgcgagcacggtggagaaaggcgtggtgccgagcgacacgctgatccaggtgtcc
atcctcgatgcgcgcggccggctcgtcgcgaacacggccgaggcgcatccgaagccgatc
gacctgtccgaccgcgagcacttcaaggtgcacatgcagcgcaacgacgacgatctctac
atcagcaagccggtgttcggccgcgtgtcgcgccactggaccctgcagatgacgcggcgc
ctgaaccatccggacggctcgttcgccggcgtggtcgtcgtgtccgaggatccggcctac
ttcacgaacgacttctacaacaacgcgacgctcggcaaggacggcgtgatcgcggtgatc
tcggatacgggcgccgtgctcgcgcgcagcacgggctccacgcagaagacgcccggcacg
ttctcggcatcgggcgtctacccggtgtcggagcgcgcctcgggcacctatgtcgatccg
atcgacggcatcgtgcgcatcgtgtcgtatcgccatctcgacggctatccgctcggcgtg
atggtgggcctgtcgcaggcggaagaattcgccgactaccaccacacgcgcaatgtctat
ctgctgatgacgggcttcatcacgctcgcgatgctcgcgttcttcggcgtcgcgacgggc
ctgatcggcaagctgctcggccgcgagcgcgaaatgacgcagctcgccgagttcgatctg
ctgacggggctcgcgaaccgctatgcgacgctgcgcagcctgcgcaacgacgtcgcgctg
ccgtcgaatctgtcgcgcctcgcgatcctgttcatcgatctcgacaatttcaagaccgtc
aacgacacgctcggccacaacgcgggcgacatcgtgctgcagatgacggccgcgcgcctg
tccgatgcggtggcgaacgaaggcgcgctcgcgcgcatcggcggcgacgagttcgtcgtc
gtcgtgaagggcgagaacgtcgagcggcgcgccgagcggctcgcggaggcgatcgtgcga
atgttcgccgagccgttcgacgtgcgcggcagctcgttcgtactgcacgcgagcatcggc
atcgcgctgcattcggtggagaacgaaagcgagatcgacttgctgaagaaggccgatctc
gcgatgtacagcgccaaggacgccggcaagaactgctaccagttctatgcgccgcacttg
tcgcaccgcgccgatcacctgatgcgctgggagcagcagttgcgcgtcgcgctgtcggac
gggcaactgttcctcgcctaccagccgaagatcgatctcacgtaccgctgcatcaccggc
ttcgaggcgctcgtgcgctgggaccatccggagcacggcgtgatctccgcgaacgaattc
atttcgatcgccgaatcgaccgggctcatcgtgccgatcggcgacttcgtgatccgcacc
gcgtgcgagcagctcgcgcgctggcgcaacgagggccacgacaagctcacgctcgccgtc
aatatctcgcccgtgcagttctggcgcggcgacctgatcgacacgatctcgcgcgcgctc
gccgagaccggaatcgaggcgcgccgcctcgagctcgagatcaccgagaccgcgatgatg
gaataccctgagctcgtatcggagaagatcgtcgcgctgaaaaggctcgggatccgcgtc
gcgctcgacgatttcggcaccggctattcgtcgctgtcctacctgcaccgcttcgcggtc
gacaccctgaaggtcgaccgctcgttcatccaggcgattccggccgaccgcagcgtgtgt
gtgatggtgtcgtcgatcgtgcacctcgcgcgctcgctcgggctcacggtcgtcgtcgag
gggacggagacggaggagcagatcgcgtggctcgccgcgctcgggcgcatcgaggcgcaa
ggcttcctgttctcgcggccggtgccctccgacggcattgcggccctgctcgcgcgcttc
ggcgtctgcggcggcgacagcgcgcgcgcggcgggccgcgacatcgcgaacgccgctaaa
cagtcgttcggcagcgactaa

DBGET integrated database retrieval system