KEGG   Burkholderia pseudomallei K96243: BPSL1086Help
Entry
BPSL1086          CDS       T00203                                 

Definition
(RefSeq) GntR family transcriptional regulator
Organism
bps  Burkholderia pseudomallei K96243
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 GntR Aminotran_MocR Aminotran_5 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-GeneID: 3094533
NCBI-ProteinID: YP_107708
UniProt: Q63W08
Position
1:1256635..1258104
Genome map
AA seq 489 aa AA seqDB search
MEASPMSTVPLAQIPAPHDTATLTLVDQLVQWARRRIDERVFRPGMRMPSIRKLALDKSV
SRFTVVEAYERLVAQGYLDSRRGSGFYVRERAPGQQPVGASGGARAQPVHNTIDVVWLLR
NMLHTVSPEKGPGLGYLPSRWLDGELITSALRALGRQSGAQMLGFGSAQGFLPLRQQLQT
RLAEFEIGATPDQLVLVSGITQAIDLIARHCVRPGDAVIVGDPAWFQMFGRFASQGAQLV
GMPYTPDGPDLDALENLVQMWRPKMLVINSVLHNPTGTSLSAAQAFRILKLAEAYDFLVV
EDDVYGDLCPPSYPATRLASLDQLRRVIFLGSFSKTLAANLRVGYIACAPELAKALTDQK
MLVGMTTPELNERVLYKVLTEGHYRRHVERLRARLDGVRDKTARMLERTGMRLFTMPAAG
MFLWADTGVDSDALAAAAHEEGFLLTPGSLFSPQQSPSTWTRFNVANCGDPALPAFLGRY
LDSVNRRAS
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
ttggaggcctccccgatgtccaccgtcccgcttgcgcagatccccgcgccgcacgatacc
gcgacgctcacgctcgtcgatcagctcgtgcaatgggcgcgccgccggatcgacgagcgc
gtgttccggcccggcatgcggatgccgtcgatccgcaagctcgcgctcgacaagagcgtg
tcgcgcttcacggtcgtcgaggcgtacgagcggctcgtcgcgcagggttatctcgattcg
cggcgcggctccggcttctacgtgcgcgagcgcgcgcccgggcagcagccggtgggcgca
tcgggcggcgcgcgcgcgcagcccgtgcacaacacgatcgacgtcgtctggctgctgcgc
aacatgctgcacacggtcagcccggaaaaggggccggggctcggctatctgccgagccgc
tggctcgacggcgaactgatcacgagcgcgttgcgcgcgctcggccggcaatcgggcgcg
cagatgctcggcttcggcagcgcgcagggcttcctgccgctgcggcagcaactgcagacg
cgcctcgccgaattcgagatcggcgcgacgcccgatcagctcgtgctcgtgtccggcatc
acgcaggcgatcgatctgatcgcgcgccactgcgtgcgcccgggcgacgcggtgatcgtc
ggcgatccggcctggttccagatgttcgggcgcttcgcgtcgcagggcgcgcagctcgtc
gggatgccgtacacgccggacggccccgatctcgacgcgctcgagaacctcgtgcagatg
tggcgcccgaagatgctcgtgatcaactcggtgctgcacaatccgacgggcacgtcgctg
tcggccgcgcaggcgttccggatcctgaagctcgcggaggcgtacgatttcctcgtcgtc
gaggacgacgtctacggcgacctgtgcccgccgagctatccggcgacgcgcctggcgagc
ctcgaccagttaaggcgcgtgatcttcctcggcagcttctcgaagacgctcgccgcgaac
ctgcgggtcggctacatcgcgtgcgcgccggaactcgcgaaggcgctgacggatcagaaa
atgctcgtcgggatgacgacgcccgagctcaacgagcgcgtgctgtacaaggtgctcacg
gaagggcactaccggcgccacgtcgagcggctgcgcgcgcggctcgacggcgtgcgcgac
aagaccgcgcggatgctcgagcgcaccggcatgcggctcttcacgatgccggcggcgggg
atgttcctgtgggccgacacgggcgtcgattcggacgcgctcgccgcggccgcgcacgag
gaaggtttcctgctcacgccggggagcctcttctcgccgcagcagtcgccttcgacgtgg
acgcgttttaacgtcgcgaactgcggcgatccggcgctgcccgcgttcctcggccgctat
ctcgacagcgtgaaccgccgcgcctcttga

DBGET integrated database retrieval system