KEGG   Burkholderia pseudomallei K96243: BPSL1089Help
Entry
BPSL1089          CDS       T00203                                 

Definition
(RefSeq) hypothetical protein
Organism
bps  Burkholderia pseudomallei K96243
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-GeneID: 3091589
NCBI-ProteinID: YP_107711
UniProt: Q63W05
Position
1:1260737..1261216
Genome map
AA seq 159 aa AA seqDB search
MMLRGFPPVASPGTHTLILGSFPGEASLAAAQYYAHPRNQFWRLLGAVLGEPQLHALPYD
ARLARVLAHGFGIWDVLAACHREGSLDAAIRHAQPNDFASLREVAPKLTKVCFNGKTAGR
FEPTIRAAGFDTLVLPSSSPANAMLSFEQKLVFWQRIVG
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
gtgatgctgcgcggctttcctcccgtcgcgtcgcccggcacgcacacgctgattctcggc
agttttcccggcgaggcgtcgctcgcggccgcgcagtactacgcgcatccgcgcaatcag
ttctggcggctcttgggggccgtgctcggcgagccgcagctgcacgcgctgccgtacgac
gcgcggctggcgcgcgtgctcgcgcacggcttcggcatctgggacgtgctcgccgcatgc
catcgcgagggcagcctcgatgcggcgattcgtcatgcgcagccgaacgatttcgcgtcg
ctgcgcgaagtcgcgccgaagctgacgaaggtgtgcttcaacggcaagacggcgggacgc
ttcgagccgacgatacgcgcggcggggttcgatacgctcgtgctgccgtcgtcgagcccg
gcgaatgcgatgctgtcgttcgagcagaagctggttttctggcagcgtatcgtcggttga

DBGET integrated database retrieval system