KEGG   Burkholderia pseudomallei K96243: BPSL1096Help
Entry
BPSL1096          CDS       T00203                                 

Definition
(RefSeq) transport related membrane protein
  KO
K05782  benzoate membrane transport protein
Organism
bps  Burkholderia pseudomallei K96243
Brite
Transporters [BR:bps02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BPSL1096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BenE
Motif
Other DBs
NCBI-GeneID: 3092612
NCBI-ProteinID: YP_107717
UniProt: Q63VZ9
Position
1:complement(1266656..1267873)
Genome map
AA seq 405 aa AA seqDB search
MSSQPPASNLPRAAARANFFTDTSPSALVAGFVAMMTGYTSSLVLMFQAGRAAHLSDAQI
SSWIWALSIGMAVTTIGLSLRYRAPIVVAWSTPGAALLVASLPGVAYSDAIGAFVVCALL
LAAVGASGLFDTLMRRIPSGIAAALLAGILFEIGIEIFRAAQFQTALVLAMFFTYLIVKR
AAPRYAIVATLAAGVAAAGALGLLDFGRFHVALARPVFTAPSFSIPAIVSIGIPLFVVAM
ASQNVPGIAVLRADGYATPSSPLIATTGIASVVLAPFGSHGINLAAITAAICTGPEAHDD
RAKRYTAAVWCGTFYLVAGVFGATIAALFGALPKALVVSVAALALFGSIMSGLTNAMQDA
RQREAALVTFMVTASGLTLLSIGSAFWGLVAGVLTQAILNARRTA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgagcagccagccgcccgcctccaacctgccgcgcgccgccgcgcgagcgaattttttc
accgacacgtcgccgtccgcgctcgtcgcgggcttcgtcgcgatgatgacgggctatacg
agctcgctcgtgctgatgttccaggccggccgcgccgcgcacctgagcgacgcgcagatc
tcgtcgtggatctgggcgctgtcgatcggcatggccgtgacgacgatcgggttgtcgctg
cggtatcgcgcgccgatcgtcgtcgcgtggtcgacgcccggcgcggcgctcctcgtcgcg
tcgctgcccggcgtcgcgtattcggacgcgatcggcgcgttcgtcgtctgcgcgctgctg
ctcgccgccgtcggcgcgagcggcctgttcgacacgctgatgcgccggattccgtccggc
atcgccgctgccctcctcgccggcatcctgttcgagatcggcatcgagatcttccgcgcc
gcgcagttccagaccgcgctcgtgctcgcgatgttcttcacgtacctgatcgtcaagcgc
gcggcgccgcgctatgcgatcgtcgcgacgctcgccgcgggcgtcgcggccgcgggcgcg
ctcggcctgctcgacttcggccgctttcacgtcgcgctcgcgcggcccgtgttcacggcg
ccgtcgttctcgatcccggcgatcgtgagcatcggcattccgctgttcgtcgtcgcgatg
gcgtcgcagaacgtgcccggcatcgcggtgctgcgcgcggacggctacgccacgccgtcg
tcgccgctcatcgcgacgacgggcatcgcgtccgtcgtgctcgcgccgttcggctcgcac
ggaatcaacctcgccgcgatcacggccgcgatctgcaccggccccgaggcgcacgacgat
cgcgcgaagcgctacacggcggccgtctggtgcggcacgttctatctcgtcgcgggcgtg
ttcggcgcgacgatcgccgcgctcttcggcgcgttgccgaaggcgctcgtcgtatcggtg
gccgcgctcgcgctgttcggctcgatcatgagcggcctcaccaacgcgatgcaggacgcg
cgccagcgcgaagccgcgctcgtcacgttcatggtgaccgcctccggcctcacgctgctg
tcgatcggctcggcattctgggggctcgtggcgggcgtgctcacgcaagcgatcctcaac
gcgcgccgcaccgcctga

DBGET integrated database retrieval system