KEGG   Burkholderia pseudomallei K96243: BPSL1097Help
Entry
BPSL1097          CDS       T00203                                 

Definition
(RefSeq) hypothetical protein
  KO
K09989  uncharacterized protein
Organism
bps  Burkholderia pseudomallei K96243
Brite
KEGG Orthology (KO) [BR:bps00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BPSL1097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA_CoxE DUF444
Motif
Other DBs
NCBI-GeneID: 3092613
NCBI-ProteinID: YP_107718
UniProt: Q63VZ8
Position
1:complement(1267966..1269141)
Genome map
AA seq 391 aa AA seqDB search
MLIDFFYSLRAAKLPVSVKEYLTLLEALKAQVIEPSLDAFYFLARLTLVKDEQYFDKFDK
AFGAYFHGVSALPADAFDIPLDWLEKRLQRELTPEEKAQIQALGGPDKLMERLKQLLDEQ
KARHEGGNKWIGTGGTSPFGHGGYNPEGVRIGGPSNGNRTAVKVWEARAYRDYDDSVEIG
TRNIKVALRRLRRFAREGAAEELDLPGTIRSTAANAGWLDLRMVPERHNNVKVLMLLDVG
GSMDDHIKRTEELFSAAKAEFKHLEFYYFHNCVYDHLWKNNRRRHAERTPTWDVLHKFTP
DYKLIFVGDATMSPYEVLQPGGSVEYNNPEAGAVWLRRLADQFPHYAWLNPEPERLWEYR
QSIAIIRDVLGDRMYPLTLAGLESAMRTLSK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgctgatcgattttttctattcgctgcgtgcggcgaagctgccggtgtcggtcaaggaa
tacctgacgctgctcgaagcgctgaaggcgcaggtgatcgagccgtcgctcgacgcgttc
tactttctcgcgcgcctgacgctcgtgaaggacgagcagtacttcgacaagttcgacaag
gcgttcggcgcgtacttccacggcgtgtccgcgctgcccgcggacgcgttcgacatcccg
ctcgactggctcgaaaagcgcttgcaacgcgagctcacgcccgaggagaaggcgcagatc
caggcgctcggcggccccgacaagctgatggagcgcctgaagcaactgctcgacgagcag
aaggcgcgccacgaaggcggcaacaagtggatcggcacgggcggcacgtcgccgttcggg
cacggcggctacaacccggagggcgtccggatcggcgggccgtcgaacggcaaccgcacc
gcggtcaaggtatgggaagcgcgcgcgtatcgcgattacgacgattcggtcgaaatcggc
acgcgcaacatcaaggtcgcgctgcggcggctgcgccgcttcgcgcgcgaaggcgcggcc
gaggagctcgatctgcccggcacgatccgcagcaccgccgcgaacgccggctggctcgat
ctgcggatggtgcccgagcgccacaacaacgtgaaggtgctgatgctgctagacgtcggc
ggctcgatggacgaccacatcaagcgcaccgaggagctcttctccgccgcgaaggccgag
ttcaagcacctcgagttctattacttccacaactgcgtatacgaccatctgtggaagaac
aaccgccgccgtcacgcggagcgcacgccgacctgggacgtactgcacaagttcacgccc
gattacaagctgatcttcgtcggcgacgcaacgatgagcccgtacgaggtgctgcagccg
ggcggctcggtcgaatacaacaatccggaggcgggcgccgtgtggctgcgccgtctcgcc
gatcagttcccgcactacgcgtggctcaatccggagcccgagcggctctgggaataccgg
cagtcgatcgcgatcatccgcgacgtgctcggcgaccggatgtatccgctcacgctcgcg
ggcctcgaatccgcgatgcgcacgctgagcaagtga

DBGET integrated database retrieval system