KEGG   Burkholderia pseudomallei K96243: BPSL1099Help
Entry
BPSL1099          CDS       T00203                                 

Definition
(RefSeq) cytochrome c
Organism
bps  Burkholderia pseudomallei K96243
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-GeneID: 3091863
NCBI-ProteinID: YP_107720
UniProt: Q63VZ6
Position
1:1270430..1270789
Genome map
AA seq 119 aa AA seqDB search
MNKFGKHVVVAAALAALAAGAQAAGVVGNPKDGASKAAMCIGCHGIDGYRVAYPEVYRVP
LLGGQNQVYLENALKAYRKKDRHFPSMNAIAESLTDQDIADLASYYAAQKPDSKNNPYK
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgaataaattcggcaaacatgtcgttgtcgcagcagcgctcgcggcgctcgccgccggc
gcgcaggcggccggtgtggtcggcaacccgaaggacggggcgagcaaggccgcgatgtgc
atcggctgtcacggcatcgacggctaccgcgtggcctacccggaggtctaccgggtgccg
ctcctcggcggccagaaccaggtttatctcgagaatgcgctgaaggcctaccggaagaag
gatcgccatttcccgtcgatgaacgcgatcgccgaatcgctgacggatcaggacatcgcc
gatctcgcgtcctactacgccgcgcaaaagcccgattcgaagaacaatccctacaagtaa

DBGET integrated database retrieval system