KEGG   Burkholderia pseudomallei K96243: BPSL1101Help
Entry
BPSL1101          CDS       T00203                                 

Definition
(RefSeq) hypothetical protein
Organism
bps  Burkholderia pseudomallei K96243
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1841
Motif
Other DBs
NCBI-GeneID: 3094149
NCBI-ProteinID: YP_107722
UniProt: Q63VZ4
Position
1:complement(1271697..1272248)
Genome map
AA seq 183 aa AA seqDB search
MPRRFVARSLRRAFGSPAAGGVKYALAGRCGPSHALLYIMFNPSRDDVRRFFIDTWRKQR
SGEILTPLEAMAADWIVEHPEYHAELEDAGRSAAHDYTPDEGRTNPFLHLSMHLAISEQL
SIDQPPGIRAAHEKLAARCDSAHDAQHAIMECLGETIWEAQRTHTPPDSDAYLQRILRRA
ARG
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
ttgcctcgccgcttcgtcgcgcgatcgctgcggcgcgctttcggcagccccgccgcgggc
ggcgtaaaatacgcgctcgcgggccgctgcggcccgtcacacgccctgctttacatcatg
ttcaatccgagccgcgacgacgtgcgtcgcttcttcatcgacacctggcgcaagcagcgt
tcgggcgaaatcctcacgccgctcgaagcgatggcggccgactggatcgtcgagcatccc
gaatatcacgcggaactcgaggacgccgggcgctcggccgcgcacgactacacgcccgac
gagggacgcacgaatccgttcctgcatctgtcgatgcatctcgcgatcagcgagcagttg
tcgatcgaccagccacccggcatccgcgccgcgcacgagaagctcgcggctcgctgcgat
tccgcgcacgatgcacagcacgcgatcatggaatgtctcggcgaaacgatctgggaagcg
cagcgcacgcacacgccgcccgattccgacgcctatctgcagcgcatcctgcggcgcgcg
gcgcgcggctga

DBGET integrated database retrieval system