KEGG   Burkholderia pseudomallei K96243: BPSL1105Help
Entry
BPSL1105          CDS       T00203                                 

Definition
(RefSeq) TetR family regulatory protein
Organism
bps  Burkholderia pseudomallei K96243
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N TetR_C_9 NolX TetR_C_4 TetR_C_10
Motif
Other DBs
NCBI-GeneID: 3093813
NCBI-ProteinID: YP_107726
UniProt: Q63VZ0
Position
1:1275668..1276300
Genome map
AA seq 210 aa AA seqDB search
MNQPKIKRDPEGTRRRILLAAAEEFATGGLFGARVDQIARRAETNERMLYYYFGSKEQLF
TAVLEYAFSALMEAERAIDLEGVAPVEAITRLAHFVWDYYRDHPDLLRLLNNENLHEARY
LQKSTRIREMISPIVKTLDGVLERGQKAGLFRTDIDSLRFYVTLSGLGYYMVSNRFTLAA
IFGRDFSAQHERAEMVKMNTELLLAFLLRR
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagccaaaaatcaaaagagacccagagggaacccggcgccggatcctgctcgcg
gcggccgaagagttcgcgacaggggggctgttcggtgcgcgagtcgaccagatcgcgcgc
cgcgccgagaccaacgagcggatgctctattactacttcggcagcaaggagcaattgttt
accgcggtgctcgaatacgcgttttccgcgctgatggaggccgagcgggcgatcgatctc
gaaggcgtcgcgcccgtcgaggcgatcacgcggctcgcgcatttcgtgtgggactactat
cgcgatcatcccgatttgctgcgcctgctcaacaacgagaatctgcacgaggcgcgctat
ttgcagaaatcgacgcgcatccgcgagatgatctcgccgatcgtcaagacgctcgacggc
gtgctcgagcgcggccagaaggcgggactctttcgcacggacatcgattcgctgcggttc
tacgtgacgctgtcggggctcggctactacatggtgtcgaaccgcttcacgctcgccgcg
atcttcggccgcgatttcagcgcgcagcacgagcgcgccgagatggtcaagatgaacacc
gagttgctgctcgcgtttctgttgaggcgctga

DBGET integrated database retrieval system