KEGG   Burkholderia pseudomallei K96243: BPSL1107Help
Entry
BPSL1107          CDS       T00203                                 

Definition
(RefSeq) hypothetical protein
Organism
bps  Burkholderia pseudomallei K96243
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-GeneID: 3091503
NCBI-ProteinID: YP_107728
UniProt: Q63VY8
Position
1:complement(1278121..1279953)
Genome map
AA seq 610 aa AA seqDB search
MPALIEDYALVGDGHTAALISRDGSVDWLCWPRFDSGACFAALVGTPEHGRWLVAPADDV
RVSATSRRYRGDTLILETDYECDEGAVTVIDFMPPGSGWSELVRIVVGRRGEMRMQMQLV
LRFDYGFSVPWVTRLPREAGVKAIAGPDTVVLRTPVPLSGENLHTVAEFTVKAEERVPFS
LSYAPSHLRLPPAREPLSMLARTENYWLEWSARCPLRGRYASAVRRSLITLKALAYEPTG
GIVAAPTTSLPEQLGGTRNWDYRYCWLRDATITLLALMRGGYYDEARAWRTWLGRVMAGS
PEQIQIMYGIAGERRLPEMELDWLPGYQDSRPVRIGNNAANQLQLDVFGEVMSALHIARV
GGLQADDTVWSVQTTLLAHLEKIWREPDEGIWETRGGRRHFTFSKVMAWVAFDRAIKSAE
MFRLSAPLERWRAIRDEIHADVCANGWNPRVRAFTQSYGSDALDASVLMLPLVGFLPPDD
PRIADTVEAIERGLMRDGLVLRYHTTEYDDGLPPGEGTFLACSFWLVDNLALLGRIDDAH
ALFRRLLSLTNDLGLLAEEYDPVTRRQVGNFPQAFSHVGLVHTAFNLMHHEEEMLRAAGQ
PAAADAVAGR
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccctcatcgaagactacgctctcgtcggcgacggccacacggccgcgctgatt
tcccgcgacggctcggtcgactggctgtgctggccccgtttcgattcgggcgcgtgcttc
gccgcgctcgtcggcacgcccgagcacggccgctggctcgtcgcgcccgcggacgacgtg
cgcgtgagcgcgacgtcgcgccgctaccgcggcgacacgctgatcctcgaaaccgactac
gagtgcgacgaaggcgccgtcaccgtgatcgatttcatgccgcccggcagcggctggtcc
gagctcgtgcgcatcgtcgtcggccggcgcggcgagatgcgcatgcagatgcagctcgtg
ttgcgcttcgactacggcttctcggtgccgtgggtcacgcggctgccgcgcgaggcgggc
gtgaaggcgatcgccggcccggacacggtcgtgctgcgcacgcccgtgccgctttcgggc
gagaacctgcatacggtggccgaattcacggtgaaggcggaggagcgcgtgccgttctcg
ctgtcgtacgcgccgtcgcatctgcggctgccgcccgcgcgcgagccgctgtcgatgctc
gcgcgcaccgagaactactggctcgaatggtcggcgcgatgcccgctgcgcggccgctac
gcgagcgccgtgcgacgctcgctgatcacgctgaaggcgctcgcgtacgagccgacgggc
ggcatcgtcgccgcgccgacgacctcgctgcccgagcagttgggcggcacccgcaactgg
gactaccgctattgctggctgcgcgacgcgacgatcacgctgctcgcgttgatgcgcggc
ggctactacgacgaggcgcgcgcgtggcgtacgtggctcggccgcgtgatggcgggctcg
cccgagcagattcagatcatgtacgggatcgcgggcgagcggcgcctgcccgaaatggag
ctcgactggctgccgggctaccaggattcgcggccggtgcgcatcggcaacaacgcggcg
aaccagttgcagctcgacgtgttcggcgaggtgatgtccgcgctgcacatcgcgcgcgtg
ggcgggctgcaggcggacgacacggtgtggtcggtccagacgacgctgctcgcgcacctc
gagaagatctggcgcgagccggacgaaggcatctgggagacgcgcggcggccgccggcat
ttcacgttctcgaaagtgatggcgtgggtcgcgttcgaccgcgcgatcaagtcggccgag
atgttccgcctgtccgcgccgctcgagcgctggcgcgcgatccgcgacgagatccacgcg
gacgtttgcgcgaacggctggaatccgcgggtgcgcgcgttcacgcagagctatggcagc
gacgcgctcgacgcgagcgtgctgatgctgccgctcgtcggtttcctgccgcccgacgat
ccgcgcatcgcggacaccgtcgaggcgatcgagcgcggcctgatgcgcgacggcctcgtg
ctgcgctaccatacgaccgaatacgacgacggcctgccgcccggcgaaggcacgtttctc
gcgtgcagcttctggctcgtcgacaatctcgcgctcctcggccgcatcgacgacgcgcac
gcgctctttcgccgcctgctgtcgctcacgaacgatctcggcttgctcgccgaggaatac
gatcccgtgacgcgccgccaggtagggaatttcccgcaggcgttctcgcatgtcgggctc
gtgcacaccgcgttcaacctgatgcatcacgaagaggaaatgctgcgcgcggccggccag
cctgccgcggcggacgccgtcgccgggcgctag

DBGET integrated database retrieval system