KEGG   Burkholderia pseudomallei K96243: BPSL1109Help
Entry
BPSL1109          CDS       T00203                                 

Definition
(RefSeq) hypothetical protein
  KO
K03466  DNA segregation ATPase FtsK/SpoIIIE, S-DNA-T family
Organism
bps  Burkholderia pseudomallei K96243
Brite
KEGG Orthology (KO) [BR:bps00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bps03036]
    BPSL1109
Chromosome and associated proteins [BR:bps03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    BPSL1109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FtsK_SpoIIIE FtsK_alpha FtsK_gamma AAA_10 DUF87 TrwB_AAD_bind T2SSE AAA_22 DEAD FtsK_4TM AAA_29 DUF815 ResIII
Motif
Other DBs
NCBI-GeneID: 3093823
NCBI-ProteinID: YP_107730
UniProt: Q63VY6
Position
1:complement(1281716..1287241)
Genome map
AA seq 1841 aa AA seqDB search
MQTVVLGWFGFSAVWFIPLFWRLVKAALPGGGGLAGPGSIRLWLGFVGVLTASCTLATAL
TGDATTNALGHALARGFEHVFGHVGTPFAMIALFVVGLPWLVGVRWRQVNAWLDASFGIR
FARERGDEEPRGVADLPRAALHRDDDRRVRRAADVQPTTAHTVNSMAPRQNGRYARPTLW
KPNDAQRGERRSASAGGAARAAAEPTAPAGWLKPGAQPRGAQPAAAMATGAAGTAAAGAS
TAGFAKVAGAAAAASEPAKTAGGAMSAHHAPKTINPPLSVGGAPKAAGPAMTGSGAAKTP
PPASAMPAPTIAAAKPAAATMPPSGLSKAERLAAPTGGAAAPLAAPAAAVTSPAAFAPAA
TGIAKPIGSTAAVAALGKRAQARPAAPDPRFAPRRPATQAAVSAARNRPMTFTPSRQTTG
ATPPQPAPRAQTAAPTAETARKRAPANPARAPLYAWHEKPAERIAPAASVHETLRSIEAS
AAQWTALAGATSTAATPVTARESMAAPAAPSGGAAASAAPDGHAPTSAETAAPNDHAPTS
AETVAPDGHVPTSAETAAPDSHAPTSAETAAPDGHAPTSAETATPNDHASTSAETAAPDS
HAPTSAETAAPDGHASTITEAAAPNGHVSATVETSAVAAPVGITQAAPPIAADTCPAGEH
VIAAVEPAGTSDSAAIGAGAIAHAEAGAAASTAETASPIGVDTHIAPSREADRTAQTAPT
APSPAEATPHVDAPHALDVAARALVGNTAATAHGAAAVDGSAQRADTASPAASTSGPPAP
VAASAASSDRAAPQPVATAAPASIATSGALGTMKAIGAAGPQPSTIAAQRASAIDDTGQP
PSTGHSTHAAVSNELGRRPHAAPDAVTPALPPAAAARAAAVPTSASAVQRQALASESAEA
AQGVARAAAAGDSRETTQVSPAGARPDKAAPSAAGANPIAPLPGASAITAHEDAPTSAAP
DAATPVIAAMDSAMPNAVAPASAIASNAGMSPASASAAAPRMASAPASAAVPNTHPPLTR
AAAAVPGVASIGVAAPGVIVTNAATALPAAPGRIASPAGASAVAPGAMTPNAASTDVAPA
AAPASDVSPNVVPAPAVGANASVPPAGASSAARHVNAPMVASTGAAAPAPSIPSSLPPST
VTSNAERRATTTAPTAAPAGLAPNPVAASSFVAPTTSAAPGQFAPAATAPADNAPAAAEA
PPGRVPNPPAGAGFVTPTSPTPGPLPPAAETPAATATPTAPPPGLAPNPPAGAGFAATPE
AVAHPFGNPSAPAPGAIPESPATAPSVALTANGTEAPGAPQAFAPSPVPAMPAAPAAADP
ASAAPAAEPVRPSRPPAPNAFEFHAPAASNVELPTLDLLEPASDTIEAISDEHLAQTGQI
IEQRLQEFKVPVTVVGASAGPVITRFEIEPALGVRGSQIVGLMKDLSRGLGLTSIRVVET
IPGKTCMGLELPNAKRQMIRLSEILASRQYQHSASQLTIAMGKDITGNPVVTDLAKAPHM
LVAGTTGSGKSVAINAMILSLLYKATPEDVRLIMIDPKMLELSVYEGIPHLLAPVVTDMK
LAANALNWCVGEMEKRYRLMSALGVRNLASFNQKIRDAAAKEKKLGNPFSLTPEDPEPLS
TLPLIVVVIDELADLMMVAGKKIEELIARLAQKARAAGIHLILATQRPSVDVITGLIKAN
IPTRVAFQVSSKIDSRTILDQMGAESLLGQGDMLFLPPGTGYPQRVHGAFVADEEVHRIV
EYLKQFGEPQYEEGILDGPSAEGGTQDLFGEAPDAEADPLYDEAVAFVVRTRRASISSVQ
RQLRIGYNRAARLVEQMEAAGLVSPMGINGSREVLAPPLPE
NT seq 5526 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacggtagttctcggctggttcggcttctcggccgtctggttcattcctcttttc
tggcggctcgtcaaggcggcgctgccgggcggcggcggcctcgcgggccctggctcgatc
cggctctggctcggctttgtgggcgtgctgacggcgagttgcacgctcgcgaccgcgctg
acgggcgacgccacgacgaatgcgctcggccacgcgctcgcgcgaggcttcgagcacgtg
ttcggccacgtcggcacgccgttcgcgatgatcgcgctgttcgtcgtcgggctgccgtgg
ctcgtcggcgtacgctggcggcaggtgaacgcatggctcgacgcgtcgttcgggattcgc
ttcgcacgcgaacgcggcgacgaggagccgcgcggcgtcgcggacctgccgcgtgccgcg
ctgcaccgcgacgacgaccggcgtgtgcgccgcgcggccgacgtgcaaccgacgaccgcg
cacacggtcaactcgatggcgccgcggcagaacggccgttatgcgcggccgacgctctgg
aagccgaacgacgcgcagcgcggcgagcgacgcagcgcgtcggcgggcggcgcggcgcgg
gccgccgccgaaccgaccgcgcctgcgggctggctcaagccgggcgcgcagccgcggggc
gcgcagccggccgccgcgatggcgacgggtgcggcgggtacggcggccgccggcgcgtcg
acagccgggttcgcgaaggtcgccggcgccgccgcggcggcgagcgagccggcgaaaacg
gccggcggcgcgatgtccgcccaccatgcgcccaagacgatcaatccgccgctgtcggtg
ggcggtgcgccgaaagcggccggcccggcgatgacgggaagcggcgccgcaaaaacgccg
cccccggcttcggccatgcccgcgccgacaatcgccgccgcgaagcccgccgcggcgacg
atgccgccgagcggtctttcgaaagcggagcgcctcgccgcgccgacgggcggagcagcc
gcgccgctcgccgcccccgcggcggccgtgacgtcgcccgccgcgttcgcgccggccgcc
accggcatcgcgaagccgatcggctcgaccgccgcggtcgcggcgctcggcaaacgcgcg
caagcgcgtccggccgcgcccgatccgcgcttcgcgccgcgccgcccggcgacgcaggcc
gccgtgtcggcggcgcgcaatcgaccgatgactttcacgccgtcgcgacagacaaccggc
gcgacgcccccacagcccgcgccccgcgcgcagacggccgcgccgaccgccgagaccgca
cgcaagcgagcgccggcaaacccggcgcgcgcgccgctctatgcgtggcacgagaagccc
gcggaacgcatcgcgcccgcggcgagcgtgcatgagacgctgcgctcgatcgaggccagc
gccgcgcaatggacggcgctcgcgggcgcaacgagcaccgccgcaacgccggtgacggcg
cgcgaatcgatggcggcgccggctgcgccgtcgggcggcgcggccgcatcggccgcgccg
gacggccacgcaccgacgagcgcggaaacggccgcaccgaacgaccatgcgccgacgagc
gcggaaacggtcgcgccggacggccacgtgccgacgagcgcggaaacggccgcgccggac
agccacgcaccgacgagcgcggaaacggccgcgccggacggccacgcaccgacgagcgcg
gaaacggccacgccgaacgaccatgcgtcgacgagcgcggaaacggccgcgccggacagc
cacgcgccgacgagcgcggaaacggccgcgccggacggccatgcgtcgacgatcacggaa
gcggccgcgccgaacggccacgtgtcggcgaccgtagaaacatccgctgtcgccgcgccc
gtaggcatcactcaagccgcgccgcccatcgccgccgacacctgccctgccggcgagcac
gtgatcgccgccgtcgaaccggcgggcacctcggattccgccgccatcggcgccggcgcg
atcgcccatgccgaagccggcgcggctgcttcgaccgccgagaccgcttcccccatcggc
gtggacacgcacatcgcacccagccgcgaagcggaccgcaccgctcagacagcgccgacc
gcgccaagcccggccgaagcaacgcctcatgtcgacgcgccacacgcgctcgatgtcgcc
gctcgcgccctcgtcggaaacaccgccgccaccgcgcacggcgccgcggccgtcgacgga
tcggcgcaacgcgccgacaccgcgtcgcctgccgcatcgacgagcggcccccccgcccct
gtcgcggcatcggccgcctcgagcgatcgcgcagccccgcaacccgttgccacggcggcg
ccggcgtcgattgcaacgtccggggccctcggcacgatgaaggcgatcggcgcagccggc
cctcaaccgtcaaccatcgccgcgcagcgtgcatcggccatcgacgataccggccagccg
ccgtcgacaggacattcgacgcatgccgccgtctcgaacgagctcgggcggcggccccat
gccgcgccagacgccgtcacgccggcattgccgcctgccgccgcggctcgcgccgcggcc
gtgccgacgagcgcgagcgccgtgcaacgtcaggcgctcgcgagcgagagcgccgaggcc
gcccaaggcgtcgcgagagcggcggccgccggcgactcgcgcgagacgacgcaggtgtcg
cccgcgggcgccaggccagacaaagccgccccgagcgccgccggggcgaacccgatcgcg
ccgttgccgggcgcatcggccatcacggcacacgaggatgcgccgacgagcgccgcgcca
gacgccgcgactccggtcattgccgcgatggatagcgccatgccgaacgcggtcgctccc
gcgtcagcaatcgcgtcgaacgcgggcatgtcgcccgctagcgcatcggctgccgcgcca
cgcatggcctcggcaccggcatcggccgccgtgccgaacacgcatcccccgctcacccgc
gcagcggccgccgtgccgggcgtcgcttcgatcggtgtggccgcgcccggcgtcatcgtg
acgaacgcggccaccgcgcttcccgccgcaccgggccggatcgcgtcgcccgccggcgcg
tcggccgtcgcgcccggcgcgatgacgccgaacgccgcctcgacggatgtcgcaccggcc
gccgccccggcaagcgacgtttcaccgaacgttgtgcccgcaccggcagtcggggcgaac
gcgagcgtgccgcccgccggcgcatcgtccgccgcccgccacgtgaatgcgccgatggtc
gcttcgacgggcgcggcagcgcccgcgccgtccattccgtcgtcgctgccgccgtcgacc
gtcacgtcgaacgccgagaggcgggccaccaccaccgcccccaccgccgccccggccggt
ctcgccccgaatccggtagccgcgtcgagctttgtcgcaccgacgaccagcgcagcgcct
ggccaatttgcgccagccgcgacggctcccgccgacaacgcccccgccgccgccgaggcc
ccgcccggtcgcgtgccgaatccgccggccggggcgggcttcgtcacgcccaccagccca
acgcccggcccactcccgcccgccgccgagacgccggccgccaccgcgacacccaccgcg
cccccgcccggcctcgccccgaatccgccggccggggcaggcttcgccgcgacaccggag
gctgtcgcccaccccttcggcaatccgagcgctcccgcaccgggcgcgatccccgagtcg
cccgccacggcgccaagcgttgcgctcacggcaaacggcaccgaagcgccgggcgcaccg
caagctttcgctccgtcgcccgttcccgcgatgccggcggcccccgccgcggccgacccg
gcgagcgccgcccccgccgccgagccggtccgcccgagccgcccgcccgcgccgaacgcg
ttcgagttccacgcgcccgccgcgtcgaacgtggagctgccgacgctcgacctgctcgag
cccgcgtccgacacgatcgaggcgatctccgacgagcacctcgcgcaaaccggccagatc
atcgagcagcgcctgcaggagttcaaggtgccggtgacggtcgtcggcgcgtcggcgggc
ccggtgatcacgcgcttcgagatcgagcccgcgctcggcgtgcgcggcagccagatcgtc
ggcctgatgaaggatctgtcgcgcggcctcggcctcacgtcgatccgcgtcgtcgagacg
atccccggcaagacctgcatgggcctcgagctgccgaacgcgaagcgccagatgatccgc
ctgtcggaaatcctcgcgtcgcgccagtaccagcattccgcgtcgcaactcacgatcgcg
atgggcaaggacatcaccggcaacccggtcgtcaccgatctcgcgaaggcgccgcacatg
ctcgtcgccggcacgacgggctcgggcaagtcggtcgcgatcaacgcgatgatcctgtcg
ctgttgtacaaggcgacgcccgaggacgtgcggctcatcatgatcgatccgaagatgctc
gagctgtcggtctacgagggcatcccgcatctgctcgcgcccgtcgtcaccgacatgaag
ctcgccgcgaacgcgctcaactggtgcgtcggcgagatggagaaacgctaccggctgatg
tccgcgctcggcgtgcgcaatctcgcgagcttcaaccagaagatccgcgacgccgccgcg
aaggaaaagaagctcggcaacccgttctcgctcacgccggaagaccccgagccgctgtcg
acgctgcccctcatcgtcgtcgtgatcgacgagctggccgatctgatgatggtcgccggc
aagaagatcgaggagctgatcgcgcggctcgcgcagaaggcgcgcgccgcgggcattcac
ctgatcctcgcgacgcagcgcccgtccgtcgacgtgatcacgggcctcatcaaggcgaac
atcccgacgcgcgtcgcgttccaggtgtcgtcgaagatcgattcgcgcacgattctcgac
cagatgggcgccgaatcgctgctcggccagggcgacatgctgttcctgccgcccggcacc
ggttatccgcagcgcgtgcacggcgcgttcgtcgccgacgaggaagtgcaccggatcgtc
gaatacctgaagcagttcggcgagccgcagtacgaggaaggcattctggacggcccgagc
gcggaaggcggcacgcaggatctgttcggcgaagcgccggatgcggaagccgatccgctc
tacgacgaggcggtcgcgttcgtcgtgcgcacgcggcgcgcgtcgatctcgtcggtgcag
cggcagttgcgcatcggctacaaccgcgcggcgcggctcgtcgagcagatggaggcggcc
ggcctggtgtcgccgatgggcatcaacggcagccgcgaagtgctcgcgccgccgctgccc
gagtga

DBGET integrated database retrieval system