KEGG   Burkholderia pseudomallei K96243: BPSL1110Help
Entry
BPSL1110          CDS       T00203                                 

Definition
(RefSeq) lipoprotein
Organism
bps  Burkholderia pseudomallei K96243
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: META
Motif
Other DBs
NCBI-GeneID: 3093824
NCBI-ProteinID: YP_107731
UniProt: Q63VY5
Position
1:complement(1287413..1287934)
Genome map
AA seq 173 aa AA seqDB search
MRLRIARSLRAPLGALTVAALLAACTMPTHPDSGAPAPDPFNPATIQLIDDTSWELVGWR
NADGSARDIPHGDNGEPIKLALSTQTGVRRAAGFSGCNRYMGTYDVKNGVLAFGPLAGTR
MACVSPARAALERDYLAALGHISKAGVQMRAPQQLVIITDADATLTFARRDGK
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgcgccttcgcatcgcccgctcgctgcgcgcgccgctcggcgcgctgaccgtcgccgcg
cttctcgccgcctgcacgatgccgacccaccccgattcgggcgcccccgcccccgatccg
ttcaaccccgcgacgatccagttgatcgacgacacgagctgggaactcgtcggctggcgc
aacgccgacggctcggcgcgcgacatcccgcacggcgacaacggcgagccgatcaagctc
gcgctgtcgacgcaaacgggcgtgcggcgcgcggccggcttctcgggttgcaaccgctac
atgggcacctacgacgtgaagaacggcgtgctcgcgttcggcccgctcgccggcacgcga
atggcgtgcgtgtcgcccgcgcgcgccgcgctcgagcgcgactacctcgccgcgctcggc
cacatctcgaaggccggcgtacagatgcgcgcgccgcagcaactggtcatcatcaccgac
gccgacgcgacgctcacgttcgcgcgacgcgacggcaagtaa

DBGET integrated database retrieval system