KEGG   Burkholderia pseudomallei K96243: BPSL1120Help
Entry
BPSL1120          CDS       T00203                                 

Definition
(RefSeq) transferase
Organism
bps  Burkholderia pseudomallei K96243
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_transf_9 Glycos_transf_N
Motif
Other DBs
NCBI-GeneID: 3092407
NCBI-ProteinID: YP_107741
UniProt: Q63VX5
Position
1:1302531..1303676
Genome map
AA seq 381 aa AA seqDB search
MSRLHGRIHIFSRALPRLVLKPLRRKPAHLRRILIAHHLLLGDTLLLTPLVAKLREQHPD
AQIVLACPKAIAPLYAKRPFGVDALAFDPRDGVSVRRLLASGPYDLGIVAGDNRHSWLAL
GAGCRWIVAHAGDAPGWKNWPVDELVPYPEAPAAWADFAAALVDGPAPRLYRPSDWPAPQ
ASAPLPAALRERPYVVLHPGASTAVKRWPSERWRELASLIEAQGYQPVWSGGPSEVEFVA
QIGPDSAQPNLAGRLGLADLWHVLAGARAVVCPDTGIAHLARLVGVPTVALFGPGNAGIH
GAGRYWRDAPFIALTIADMPCRDQPSMFRRHVAWVRRCDRSAQTCVAWRGDHADCMGRLS
VDAVHRALQNVLALAPSSSSR
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgagcagactccacggccggatccacatcttctcgcgagcgctgccgaggcttgtcctc
aagccgttgcggcgcaagcccgcgcacctgcggcgcattctgatcgcgcatcacctgctg
ctcggcgatacgttgctgctgacgccgctcgtcgcgaagctgcgcgagcagcatccggat
gcgcagatcgtgctggcgtgcccgaaggcgattgcgccgctctacgcgaagcgtccgttc
ggcgtcgatgcgttggcgttcgacccgcgcgacggcgtatcggtcaggcgtctgctcgcg
tcggggccgtatgatctcggcatcgtcgcgggcgacaaccgccacagctggcttgcgctt
ggcgcgggctgccgctggatcgtcgcacatgcgggggatgcgcccggatggaagaactgg
ccggtcgacgaactggtgccgtatccggaggcgcccgccgcttgggccgatttcgccgcg
gcgctcgtcgacgggcccgcgccgcgcctgtatcgcccgtccgactggccggcgccgcag
gcaagcgcaccgctgcccgccgcgttgcgcgagcgcccctacgtggtgttgcatccgggc
gcgagcacggcagtcaagcgctggccgtccgaacgctggcgcgagctcgcgagcctcatc
gaggcgcaaggctatcagcccgtctggagcggcgggccgagcgaagtcgagttcgtcgcg
cagatcggtcccgattccgcgcagccgaatctcgccggccggctcgggctcgccgatctg
tggcacgtgcttgccggtgcacgggcggtcgtgtgtccggataccggcatcgcgcatctc
gcgcgtctcgtcggcgtgcccaccgtcgcgctgttcggccccggcaatgccggcattcac
ggcgcggggcgctattggcgggacgcgccgttcatcgcgctgacgatcgcggacatgccg
tgccgcgaccagccgtccatgttccggcgccatgtcgcatgggtacggcgctgcgaccgg
agtgcgcagacgtgcgtcgcgtggcgcggcgatcatgcggactgcatggggcgtctttca
gtggatgcggtgcatcgtgcgctgcaaaacgttttggcgcttgcgccgtcaagttcaagc
cgatga

DBGET integrated database retrieval system