KEGG   Burkholderia pseudomallei K96243: BPSL1128Help
Entry
BPSL1128          CDS       T00203                                 

Definition
(RefSeq) lipoprotein
Organism
bps  Burkholderia pseudomallei K96243
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRC
Motif
Other DBs
NCBI-GeneID: 3093796
NCBI-ProteinID: YP_107750
UniProt: Q63VW6
Position
1:complement(1311772..1312755)
Genome map
AA seq 327 aa AA seqDB search
MMSGGFPRSAFRLPRPVAAAAPVVLATLALSGCALFRAPQASAPVVEAVAVPVEPASEPI
AAPEPASAPEPAETAPPKKPHREAAPPRKPARVAPPAPAPAPAPAPLVTTRAIERSQVHA
LLDSEVRRGGKVIGRAVDMTADANGAPREMLVNLQGFMGVGDRKVSFPWKLFRFTPGGRH
EPVILDMPATAQLQPADRPKAVPLTGSTQAGAEPGQMRIIDADVERPNGAKVGRVVDVLI
GRDAQPQAVVLDVGGLVDPDRRTIAANWSALRFAPKDKSLRALLDLNDAQLKASPPYAGD
KPILAVSPAAGGAPAAAPATARAGAKR
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
ttgatgagcggcggattcccgcgttctgccttccgtcttccccgtcccgtcgccgctgcg
gcacccgtcgtcctcgccacgctcgcgctgtccggttgcgcgctgttccgcgcgccgcaa
gcgagcgcgcccgtcgtggaagccgtcgccgtgcccgtcgagccggcgagcgagcccatc
gcggcgcccgagcccgcgagcgcgcccgaacccgccgagaccgcgccgccgaagaagccg
caccgcgaggccgcgccgccgcgcaagcccgcgcgcgtcgcgccgccggcgcccgcgccg
gcccccgcgcccgcgccgctcgtgacgacgcgcgcaatcgagcgcagccaggtgcacgcg
ctcctcgacagcgaggtgcggcgcggcggcaaggtgatcggccgcgcggtcgacatgacg
gcggacgcgaacggcgcgccgcgcgagatgctggtgaacctgcaaggcttcatgggcgtc
ggcgaccgcaaggtcagcttcccgtggaagctgtttcgcttcacgccgggcggcaggcac
gagccggtcatcctcgacatgccggccactgcgcagttgcagcccgccgaccgtccgaag
gcggtgccgctcacgggctcgacgcaggcgggcgccgaacccggccagatgcggatcatc
gacgccgacgtcgagcgcccgaacggcgcgaaggtcggccgcgtcgtcgacgtgctgatc
ggccgcgatgcgcaaccacaggcggtcgtgctcgacgtcggcggcctcgtcgatccggac
cggcgcacgatcgccgcgaactggtcggcgctgcgcttcgcgccgaaggacaaatcgctg
cgcgcgctgctcgacctgaacgacgcgcaactgaaggcgtcgccgccctatgcgggcgac
aagccgatcctcgccgtctcgcccgcggccggcggcgctcccgccgccgcgccggctacc
gctcgagcaggtgcgaaacgatga

DBGET integrated database retrieval system