KEGG   Burkholderia pseudomallei K96243: BPSL1130Help
Entry
BPSL1130          CDS       T00203                                 

Definition
(RefSeq) sigma factor
  KO
K03088  RNA polymerase sigma-70 factor, ECF subfamily
Organism
bps  Burkholderia pseudomallei K96243
Brite
KEGG Orthology (KO) [BR:bps00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bps03021]
    BPSL1130
Transcription machinery [BR:bps03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     BPSL1130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r2 Sigma70_r4_2 Sigma70_r4 DUF4440 SnoaL_2
Motif
Other DBs
NCBI-GeneID: 3091502
NCBI-ProteinID: YP_107752
UniProt: Q63VW4
Position
1:complement(1314397..1315290)
Genome map
AA seq 297 aa AA seqDB search
MTETSRPAPSDEPFAALRPRLFSIAYRMLGTRADAEDVLQDAWLRWHQAERDTLDSPEAW
LVTVVTRLSIDRLRAAKAQRDAYVGWWLPEPLVDIDERTPEAAAEFADDLSVALLWVLER
LSPEERAAFLLRQAFERDYAEIAQLLDKSEAACRQLVHRASTRVQQEHRRFDVSRERHRQ
LVERFARAAASGERNAIRALLADDVELVGDGGGKVPSFFKVLRGALRIANLYWAVGRRHA
GQIEYRLAQINGEPGLLRFIDGRIESAQAFATDGARIVAIYAVRNPDKLAHIPNRPA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaacctcccgtccggcgccgtccgacgaaccgttcgccgcgctgcgtccgcgc
cttttctcgatcgcgtaccgaatgctcggcacgcgcgccgatgccgaagacgtgctgcag
gacgcctggctgcgctggcaccaggccgaacgcgacacgctcgattcgcccgaggcatgg
ctcgtcacggtcgtcacccggctgtcgatcgatcggctgcgcgccgcgaaggcgcagcgc
gacgcctatgtcggatggtggctccccgagccgctcgtcgacatcgatgagcgcacgccc
gaggccgcggccgagttcgccgacgacctgtcggtggcgctactgtgggtgctcgaacgg
ctctcgcccgaggaacgcgcggcattcctgctgcgccaggcgttcgagcgcgactacgcg
gaaatcgcgcaactgctcgacaagagcgaagcggcctgccgccagctcgtccaccgcgcg
tcgacgcgcgtgcagcaggaacaccggcgcttcgacgtatcgcgcgagcgccaccggcaa
ctcgtcgagcgcttcgcgcgcgccgcggcaagcggcgagcgcaacgcgatccgggcgctg
ctcgccgacgacgtggaactggtcggcgacggcggcggcaaggtgccgtcgttcttcaag
gtgctgcgcggcgcgctccggatcgcgaatctgtattgggccgtcggccgacgccatgcc
gggcagatcgaataccggctcgcgcaaatcaacggcgaaccgggcctgctgcgcttcatc
gacgggcggatcgaatcggcacaggcgttcgccaccgacggcgcgcggatcgtcgcgatc
tacgcggtgcgcaatccggacaagctcgcgcatattccgaaccgcccggcgtga

DBGET integrated database retrieval system