KEGG   Burkholderia pseudomallei K96243: BPSL1134Help
Entry
BPSL1134          CDS       T00203                                 

Definition
(RefSeq) hypothetical protein
Organism
bps  Burkholderia pseudomallei K96243
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: V_ATPase_prox
Motif
Other DBs
NCBI-GeneID: 3093357
NCBI-ProteinID: YP_107755
UniProt: Q63VW1
Position
1:1318558..1319238
Genome map
AA seq 226 aa AA seqDB search
MLAMIGVAVAGWRYVSPSQTAVAQSLKPGAASDERGGPPARARTDDAPAPAGPAERRLDL
VALRKSLEGRDDAQAQVQRIVAFARFRDRIAAYGEGRNSMPAEERARLAREILAELPEHV
ARNEIVPVQAEALSAALLADATSDSRTRDAAIQSMRQQWDAYAGRTVGPSPASDPRYLAY
ARQSRDIVAQVQASVPDPDQQQAVIAQRLQALRVQLFDQASRSDTR
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
ttgttggcgatgatcggcgtcgcggtggcgggatggcgatacgtgtcgccgtcgcagacc
gccgtcgctcagtcgctgaagcccggcgcggcctcggacgaacgcggcgggccgccggcg
cgggcgcggacggatgatgcgcccgcgccggcggggcccgccgagcgcaggctggatctc
gtcgcgctgcgcaagagcctcgagggccgcgacgacgcgcaggcgcaagtgcagcgtatc
gttgccttcgcccgctttcgcgaccggatcgccgcatacggcgaaggtcgaaacagcatg
cccgccgaagagcgggcgcggctcgcccgcgagatcctggcggagttgcccgagcacgtc
gcgcgcaacgaaatcgttcccgtgcaagccgaggcgctcagcgcggcattgctcgcggat
gcgacgtcggattcccgcacgcgcgacgcggccatccagtcgatgcggcaacagtgggac
gcctatgccgggcggaccgtggggccgtcgcccgcgagcgatccacgctatctcgcctac
gcgcggcagagccgggacatcgtcgcgcaggtgcaggcaagcgttcccgatcccgatcag
caacaggccgtcatcgcgcagcgcctgcaggcgctgcgcgttcaactgttcgaccaggca
tcccgatccgatacccgttga

DBGET integrated database retrieval system