KEGG   Burkholderia pseudomallei K96243: BPSL1500Help
Entry
BPSL1500          CDS       T00203                                 

Gene name
recR
Definition
(RefSeq) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bps00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BPSL1500 (recR)
DNA repair and recombination proteins [BR:bps03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     BPSL1500 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BPSL1500 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_5 zf-RING_9 PHF5 HHH_8 HHH_3
Motif
Other DBs
NCBI-GeneID: 3091893
NCBI-ProteinID: YP_108120
UniProt: Q63UU6
Position
1:1738571..1739179
Genome map
AA seq 202 aa AA seqDB search
MRMSIKPPSALSELVEALRALPGVGPKSAQRIAYHLMQHDREGAERLGRSLLFATEHLRH
CEKCNTFTEAQVCEVCSDPERDPALLCVVETPADQIMLEQTMTYRGLYFVLMGRLSPLDG
IGPKEIHFDRLVRRASDGIVKEVVLATNFTNEGEATAHYLGQTLKARGLAVTRLARGVPV
GGELEYVDAGTIARAMLDRRTL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcatgagcatcaagccgccgtccgcgctgtccgagctcgtcgaggcgctgcgcgcg
ctgccgggcgtcgggccgaaatccgcgcaacgcatcgcgtaccacctgatgcagcacgat
cgggagggcgccgagcggctcggccggtcgctgctgttcgcgaccgagcacctgcggcat
tgcgagaagtgcaacacgttcacggaggcgcaagtctgcgaggtgtgcagcgatccggag
cgcgatccggcgctgctgtgcgtcgtcgagacgcccgccgatcagatcatgctcgagcag
acgatgacctatcgcgggctgtacttcgtgctgatggggcgcctgagcccgctcgacggc
atcgggccgaaggaaatccatttcgaccggctcgtgcgccgcgcgtccgacggcatcgtg
aaggaggtcgtgctcgcgacgaacttcacgaacgagggcgaggcgaccgcgcactacctc
ggccagacgttgaaggcgcgcggcctggccgtcacgcggctcgcgcgtggcgtaccggtg
ggcggcgagctcgaatacgtcgatgcgggcacgatcgcgcgcgcgatgctcgaccggcgc
acgctttag

DBGET integrated database retrieval system