KEGG   Burkholderia pseudomallei K96243: BPSL1744Help
Entry
BPSL1744          CDS       T00203                                 

Gene name
arcB
Definition
(RefSeq) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps00220  Arginine biosynthesis
bps01100  Metabolic pathways
bps01110  Biosynthesis of secondary metabolites
bps01130  Biosynthesis of antibiotics
bps01230  Biosynthesis of amino acids
Module
bps_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:bps00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BPSL1744 (arcB)
Enzymes [BR:bps01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     BPSL1744 (arcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-GeneID: 3092910
NCBI-ProteinID: YP_108344
UniProt: Q63U72
Position
1:2056648..2057658
Genome map
AA seq 336 aa AA seqDB search
MSFNLHNRNLLSLIHHNARELRYLLDLARDLKRAKYSGTEQPRLLRKNIALIFEKTSTRT
RCAFEVAAYDQGANVTYIDPASSQIGHKESMRDTARVLGRMYDAIEYRGFSQEIVEELAH
HAGVPVFNGLTDEYHPTQMLADVMTMREHSDKPLHDIRYAYLGDARNNMGNSLLLIGAKL
GMDVRIGAPKSLWPAADFIAQCEAFAAESGARLTLTEDPYEAVKGVDFIHTDVWVSMGEP
VEAWDERINALLPYQVNRKLIESTGNPRTRFMHCLPSFHNCETKVGKQIAERYPHLKDGI
EVTDEVFESPRCIAFEQAENRMHTIKAVLVSTLGGI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcaacctgcacaaccgcaacctgctgagcctgatccaccacaacgcgcgcgag
ctgcgctatctgctcgacctcgcgcgggatctcaagcgcgcgaagtacagcggcaccgag
cagccgcgcctgctgcgcaagaacatcgcgctcatcttcgagaagacctcgacccgcacg
cgctgcgcgttcgaagtcgccgcatacgatcagggcgcgaacgtcacgtacatcgatccg
gcttcgtcgcagatcggccacaaggaaagcatgagggacacggcgcgcgtgctcgggcgg
atgtacgacgcgatcgagtaccgtggcttcagccaggagatcgtcgaggagctcgcgcac
cacgcgggcgtgcccgtcttcaacgggctcaccgacgaataccatccgacgcagatgctc
gccgacgtgatgacgatgcgcgagcacagcgacaagccgctgcacgacatccgctacgcc
tatctcggcgacgcgcgcaacaacatgggcaattcgctgctcctgatcggcgcgaagctc
gggatggacgtgcggatcggcgcgccgaagtcgctctggcccgcggccgacttcatcgcg
cagtgcgaggcgttcgcggccgagagcggcgcgcggctcacgctgaccgaggacccgtac
gaagcggtcaagggcgtcgacttcatccacaccgacgtatgggtgtcgatgggcgagccc
gtcgaagcctgggacgagcggatcaacgcgctcctgccgtatcaggtgaaccgcaagctg
atcgaatcgacgggcaatccgcgcacgcgcttcatgcactgcctgccgtcgttccacaac
tgcgagacgaaggtcggcaagcagatcgccgagcgctatccgcacctgaaggacggtatc
gaagtcaccgacgaagtgttcgaatcgccgcgctgcatcgcgttcgagcaggcggaaaac
cgcatgcacacgatcaaggcggtcctcgtgtcgacgctcggcggcatctga

DBGET integrated database retrieval system