KEGG   Burkholderia pseudomallei K96243: BPSL2047Help
Entry
BPSL2047          CDS       T00203                                 

Definition
(RefSeq) hypothetical protein
Organism
bps  Burkholderia pseudomallei K96243
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2235
Motif
Other DBs
NCBI-GeneID: 3092586
NCBI-ProteinID: YP_108645
UniProt: Q63TC1
Position
1:complement(2446979..2449387)
Genome map
AA seq 802 aa AA seqDB search
MSYRFASADRFDVNVVTKDEQDAILRRLHEDDGMACCKTLHIGIFFDGTRNNADRDRGAR
TESNVARLYAAFPIDKYHQAIYVAGVGTPFVEQIGDFGVGLQAAAGAAAGWAGEGRINWA
LLRIHDILHAYVHGQTLTAVLGKRYEELVKSMSLDMNFKGIDLGGTPPKPGSFGDIKLRA
NSGVGALKLIAAEQNGVELTWDLDTNWAQLKNELDSSKWNAAVQEWDAKRRKVLLDRRAQ
LKARIGDLLVKGKPKLQRIRLYVFGFSRGAAEARTFSNWLADALDPDFSLCGVPVSYDFL
GIFDTVASVGIAQSAAATLFDGHGGWGRKELMAVPHYVRRCVHMVAAHEPRGSFPLDLID
CSMDGREEIVYPGVHSDVGGGYGPGEQGRGRDDADKLSQVPLLDMYREARKAGVPLDING
PGIGADVIAAFKVSAGLKQAFAAYVKKSENYYYEKDHGTPGLMRCHYGLYLRWRKMRLKD
MHAQPSFKAAQARYPQDAADLDSANAELKEEWNDLLEVEKAGGPTITRYVEKFVTKWASE
NPKTAAVVSTSLLPAAVAAEVFVPGVSAATVLFGDKVVKLVQAQLKEKWEQWLQVRSDWN
MGPPEPAISALYDNYMHDSRAWFKPLGDDDDVWNHRQIQELKTKQASFERAHAAWKKRVE
MGMPSLLQVTQAMGVGSTGWGPVGGLPPEPEPRSPLTAQQADLLKRYDAAMQSAKQARAA
KDPNAPTDSAVLTDPKVTGGLALQTSGREFYFLWGFLRWRTVFVNGVRWDQPRVPTVQEE
MEGMRMQMQRQVDMKGIGVLFQ
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atgagttatcgtttcgcatccgccgaccgatttgatgttaatgtcgttacgaaagacgag
caggacgctattttgcggaggctgcatgaagatgacggcatggcttgttgtaagacattg
catatcggaatcttctttgatggtacgcgtaacaacgctgatcgggataggggggcgcga
acggaaagcaatgtggcacggctttatgccgcttttccaatagataaatatcaccaagcg
atttacgttgctggagttggcacgccttttgtcgagcagattggtgatttcggtgttggc
ttacaggcggccgcaggagctgcggcaggttgggcgggagaggggcgaattaactgggct
ttgcttcggattcacgatattttgcatgcgtatgttcacggtcagacgttaacggcagtg
ttaggaaagcgctacgaggaactcgtaaaatcgatgagcctcgatatgaattttaagggc
atcgaccttggcggaacgccgcctaaaccgggaagcttcggcgatatcaaattgcgtgcc
aattctggtgtgggggcgctcaagctgattgctgccgaacagaatggtgtcgagctgact
tgggatttagatacgaattgggcgcagctcaaaaacgagttggattcgtcgaagtggaat
gcagccgtgcaagaatgggacgccaagcgccgtaaggtattgctcgatcgtcgtgctcag
ctaaaagcgcgcatcggtgatctgctggtcaaggggaagccgaagctgcaacgcattcgg
ctatacgtattcggcttttcgcgcggtgcagcggaggctcgcactttctcgaactggctt
gctgacgcgcttgaccccgatttcagtttgtgtggagtgccggtttcatacgattttctc
ggtatctttgatacggtcgcatcggtcggcatcgctcagagcgccgccgcaacattattc
gacggacatggaggatgggggcgcaaggaactgatggccgtgccgcattatgtgcgccgt
tgcgtgcacatggtggcggcacatgaacctcgtggatcatttccgctcgaccttatcgat
tgttcgatggacggtcgtgaggagattgtctacccgggtgttcactcggacgtcggcggc
ggctatgggccgggcgaacaggggcgcggtcgggacgacgccgacaaactttcgcaagtc
ccgctgcttgatatgtaccgggaggcgcgtaaggcaggtgtgcccttggatatcaatggg
ccaggtatcggcgcggacgtcatcgctgcattcaaggtttcagcagggctaaaacaagcc
ttcgcagcctacgtaaaaaagagcgagaactattattacgagaaagatcacggcacgccg
ggcctaatgcgttgccattacggcttgtatctccggtggcgcaagatgcggctcaaggac
atgcatgcacagcccagcttcaaggctgcgcaggcgcgctatccgcaagatgcagcggat
ctggacagtgcgaacgcggaattgaaggaggagtggaacgatttgctggaggtcgagaaa
gctggcggcccgacaatcacccgatacgtggagaagtttgttacgaaatgggccagtgag
aatccgaaaacggccgccgtcgtttccacgtctctacttccggccgcggtcgctgctgag
gtttttgttccgggggttagcgctgcgacggttctattcggcgacaaagtggtgaaactg
gtgcaagcccaactcaaggagaagtgggagcagtggctgcaagttcgcagcgactggaac
atggggccgcctgaacctgcgatcagcgcactctacgacaactacatgcacgactcccgc
gcatggttcaagccgctcggcgacgatgacgacgtgtggaaccataggcagattcaggaa
ctcaagaccaagcaagccagctttgaacgcgcccatgctgcctggaaaaagcgtgtcgaa
atgggcatgccaagcttgttgcaggttacacaggcaatgggcgtaggttccacaggatgg
gggcccgtcggcgggcttccgcccgaacccgaaccccgctccccgctcaccgcccagcaa
gccgatctgctcaagcgctacgacgccgcgatgcagtccgccaagcaggcacgcgccgca
aaggacccgaacgcgccgacggacagcgccgtgctgaccgatccgaaggtgacgggcggc
ctcgcgctgcaaaccagcggccgcgagttctatttcctgtggggcttcctgcgctggcgg
accgtgttcgtgaacggcgtgcgctgggaccagccgcgcgtgccgacggtgcaggaggaa
atggagggcatgcgcatgcagatgcagcgccaggtcgacatgaagggcatcggcgtactg
ttccaatga

DBGET integrated database retrieval system