KEGG   Burkholderia pseudomallei K96243: BPSL2394Help
Entry
BPSL2394          CDS       T00203                                 

Gene name
hisQ
Definition
(RefSeq) histidine ABC transporter permease
  KO
K10016  histidine transport system permease protein
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bps00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BPSL2394 (hisQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bps02000]
    BPSL2394 (hisQ)
Transporters [BR:bps02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    BPSL2394 (hisQ)
   Histidine transporter
    BPSL2394 (hisQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-GeneID: 3094254
NCBI-ProteinID: YP_108986
UniProt: Q63SD0
Position
1:complement(2890684..2891373)
Genome map
AA seq 229 aa AA seqDB search
MFLYGFGPLIWAGTVQTIELSVLSLAAAVLLGLVGAVAKLSHNRVLRAIATGYTTLIRSV
PDLVLMLLLFYSIQIWLNQFTDLMSWDQIDIDPFVAGVLTLGFIYGAYFTETFRGAFLAV
PRGQLEAGSAYGMNGMRVFARIMFPQMMRFALPGIGNNWQVLVKATALVSIIGLADVVKA
AQDAGKSTFNMFFFILVAALIYLAITTASNLVLRQLEKRYSIGVRHAEL
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
gtgtttctatacggctttggcccgctcatctgggcgggcaccgtgcagacgatcgagctg
tcggtgctgtcgctcgcggcggcggtgctgctcggcctcgtcggcgcggtcgcgaagctc
tcgcacaatcgcgtgctgcgcgcgatcgcgacgggctacacgacgctcattcgctcggtg
cccgatctcgtgctgatgctgctgctgttctacagcatccagatctggctcaatcagttc
accgatctgatgagctgggatcagatcgatatcgatccgttcgtcgccggcgtgctgacg
ctcgggttcatttacggcgcgtacttcaccgaaacctttcgcggcgcgttcctcgcggtg
ccgcgcggccagctcgaggcgggcagcgcgtacgggatgaacgggatgcgcgtgttcgcg
cgaatcatgtttccgcagatgatgcgcttcgcgctgccgggcatcggcaacaactggcag
gtgctcgtgaaggcgaccgcgctcgtgtcgatcatcggtctggccgacgtcgtcaaggcc
gcgcaggacgcgggcaagagcacgttcaacatgttcttcttcattctcgtcgcggcgctc
atctacctggcgatcacgacggcctccaatctcgtgctcaggcaactcgagaaacgttat
tccatcggcgtgaggcacgcggaactatga

DBGET integrated database retrieval system