KEGG   Burkholderia pseudomallei K96243: BPSL2563Help
Entry
BPSL2563          CDS       T00203                                 

Gene name
gmk
Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps00230  Purine metabolism
bps01100  Metabolic pathways
Module
bps_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bps00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BPSL2563 (gmk)
Enzymes [BR:bps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     BPSL2563 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 RsgA_GTPase MMR_HSR1 ABC_tran AAA_22 AAA_18 AAA_16 AAA_29 Septin AAA_23 Dynamin_N cobW Viral_helicase1
Motif
Other DBs
NCBI-GeneID: 3092895
NCBI-ProteinID: YP_109160
UniProt: Q63RV7
Position
1:complement(3092773..3093456)
Genome map
AA seq 227 aa AA seqDB search
MTDSNRDGAAAHSLHAGVYPGNLFMVVAPSGAGKSTLVNALLSKDPEIRLSISYTTRKPR
PGEQDGQHYHFTTVEDFRERHARHEFLESAEVHGNYYGTSRVWIEEQMKIGHDVLLEIDW
QGAQQVKKQFRNAVGIFILPPSLAALEERLKKRGQDEPNVITRRLLAAGSEIAHAAEAQY
VVINETFEHALAELECIVAATRLRFTSQYARHAELFVELGIHLPHAE
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaccgattcgaaccgcgacggcgcagccgcgcattcgctgcacgccggcgtctatccc
ggcaatctcttcatggtcgtcgcgccgtcgggcgcgggcaagtcgacgctcgtcaacgcg
ctgctgtcgaaggacccggagattcgcctgtcgatttcgtacacgacgcgcaagccgcgc
cccggcgaacaggacggccagcactatcacttcacgaccgtcgaggatttccgcgagcgc
catgcgcgccacgagtttctcgaaagcgccgaggtgcacggcaattactacggcacgtcg
cgcgtgtggatcgaagagcagatgaagatcggccacgacgtgctgctcgaaatcgattgg
cagggcgcgcagcaggtgaagaagcagttccgcaacgcggtcggcatcttcatcctgccg
ccgtcgctcgcggcgctcgaggagcggctcaaaaagcgcgggcaggacgagccgaacgtg
atcacgcggcgcctgctcgccgcgggcagcgagatcgcgcacgcggcggaagcgcagtac
gtcgtcatcaacgagaccttcgagcacgcgctcgccgagctcgagtgcatcgtcgcggcg
acgcgcctgcgcttcacgtcgcaatatgcgcggcatgccgaactattcgtcgagctcggc
attcatctgccgcacgcggagtga

DBGET integrated database retrieval system