KEGG   Burkholderia pseudomallei K96243: BPSL2566Help
Entry
BPSL2566          CDS       T00203                                 

Definition
(RefSeq) deoxyribonucleotide triphosphate pyrophosphatase
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:bps00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BPSL2566
Enzymes [BR:bps01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     BPSL2566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like PBAN
Motif
Other DBs
NCBI-GeneID: 3092716
NCBI-ProteinID: YP_109163
UniProt: Q63RV4
Position
1:3095292..3095918
Genome map
AA seq 208 aa AA seqDB search
MSHASPDAARSRIVLASNNPGKLREFAALFSTAGIDIVPQGELGVSEADEPHATFVENAL
AKARHASRATGLPAVADDSGLCVPALLGAPGVYSARYAQRAGREKSDAANNAYLVEQLRE
VADRRAYYYCVLALVRHADDPEPLIAEGRWAGEIVDAPRGAHGFGYDPHFFVPALGATAA
ELDPAAKNAASHRALALKALVARLGEIR
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcacgcatcgcccgacgccgcgcgctcgcgcatcgtcctcgcctcgaacaatccc
ggcaagctgcgcgagttcgccgcgctcttctcgacggcgggcatcgacatcgtgccgcaa
ggcgagctcggcgtatcggaagccgacgaaccgcacgcgaccttcgtcgagaacgcgctc
gcgaaggcacgccatgcgtcgcgcgcgacgggcctgcccgccgtcgccgacgattccggc
ctgtgcgtgcccgcgctgctcggcgcgccgggcgtctactcggcgcgctacgcgcagcgc
gccggccgcgagaagagcgatgcggcgaacaacgcgtatctcgtcgagcagttgcgcgag
gtcgcggatcggcgcgcgtattactactgcgtgctcgcgctcgtgcggcacgcggacgat
ccggagccgctcatcgccgaagggcgctgggcgggcgagatcgtcgacgcaccacgcggc
gcgcacggcttcggctacgatccgcacttcttcgtgccggcgctcggcgcgacggcggcc
gagctcgatccggccgcgaaaaacgcggcgagccatcgcgcgctcgcgctgaaggcgctc
gtcgcgcggctcggagaaattcgatga

DBGET integrated database retrieval system