KEGG   Burkholderia pseudomallei K96243: BPSL2837Help
Entry
BPSL2837          CDS       T00203                                 

Definition
(RefSeq) carbon-nitrogen hydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
bps  Burkholderia pseudomallei K96243
Brite
KEGG Orthology (KO) [BR:bps00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BPSL2837
Enzymes [BR:bps01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     BPSL2837
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-GeneID: 3091839
NCBI-ProteinID: YP_109431
UniProt: Q63R37
Position
1:3396632..3397459
Genome map
AA seq 275 aa AA seqDB search
MTDRHASASPFPVAALQMVSTPDRERNLAEAGRLIADAAASGARLVLLPEYFCFMGHQDT
DKLALAEAYRDGPIQRFLAERAKAHGIWVIGGTLPLKAPEPSRVLNTTLVFDPQGREAAR
YDKIHLFNFEKGDESFDEARTIRPGDAVRTFDAPFGRVGLSVCYDLRFPELYRRMGDCAM
IVVPSAFTYTTGRAHWETLLRARAVENQCYVLAAAQGGKHENGRRTWGRSMLVDPWGEIV
AVRDEGAGVVAGEIDPARIADVRQSLPAWRHRVLA
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcgccacgcctcagcctcgccgttcccggtcgccgcgctgcagatggtcagc
acgcccgatcgcgagcgcaatctcgccgaagccggccggctgatcgccgatgcggcggcc
tcgggcgcacggctcgtgctgctgcccgaatatttctgcttcatgggccaccaggacacc
gacaagctcgcgctcgcggaagcgtaccgtgacggcccgatccagcgctttctcgccgag
cgcgcgaaggcgcacggcatctgggtgatcggcggcacgctgccgctgaaggcgcccgag
ccgtcgcgcgtgctgaacacgacgctcgtgttcgatccgcaaggccgcgaggccgcccgc
tacgacaagatccacctgttcaacttcgagaagggcgacgagtcgttcgacgaggcgcgc
acgatccgcccgggcgacgcggtgcgcacgttcgacgcgccgttcggccgggtcgggctg
tcggtctgctacgatctgcgctttccggagctgtaccggcgaatgggcgactgcgcgatg
atcgtcgtgccgtcggcgttcacgtacacgacggggcgcgcgcactgggagacgctgttg
cgcgcccgcgcggtcgagaaccagtgctacgtgctcgccgccgcgcaaggcggcaagcac
gagaacggccgccgcacgtgggggcgcagcatgctcgtcgatccgtggggcgagatcgtc
gcggtgcgcgacgaaggcgcgggcgtcgtcgcgggcgagatcgatcccgcgcggatcgcc
gacgtgcggcagagcctgcccgcgtggcggcatcgcgtgctcgcgtga

DBGET integrated database retrieval system