KEGG   Burkholderia pseudomallei K96243: BPSL2898Help
Entry
BPSL2898          CDS       T00203                                 

Gene name
ruvA
Definition
(RefSeq) Holliday junction DNA helicase RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bps00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BPSL2898 (ruvA)
Enzymes [BR:bps01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BPSL2898 (ruvA)
DNA repair and recombination proteins [BR:bps03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BPSL2898 (ruvA)
    RecFOR pathway proteins
     BPSL2898 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH HHH_8 IMS_HHH Transposase_20 Cdd1 HHH_3 5_3_exonuc
Motif
Other DBs
NCBI-GeneID: 3092278
NCBI-ProteinID: YP_109492
UniProt: Q63QX6
Position
1:3468011..3468592
Genome map
AA seq 193 aa AA seqDB search
MIGRIAGTLLEKNPPHILVDCNGVGYEVDVPMSTFYNLPHTGEKVVLLTQLIVREDAHLL
YGFLTPPERSTFRELLKITGVGARMALAVLSGMSVAELSQAVTLQDAARLTRVPGIGKKT
AERLLLELKGKLGADLGPLAGAASPSDHATDILNALVALGYSEKEALAAIKNVPAGTGVS
EGIKLSLKALSKA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtcgcatcgccggcaccctcctcgaaaaaaatccgccgcacatcctcgtcgac
tgcaacggcgtcggctacgaagtcgacgtgccgatgagcacgttctacaacctgccgcac
acgggcgagaaggtcgtgctgctgacccagttgatcgtccgcgaggacgcgcacctgctg
tacggctttctcacgccgccggagcgctcgacgttccgcgagttgctcaagatcacgggc
gtcggcgcgcggatggcgcttgccgtgctgtccggcatgagcgtcgcggaactgtcgcaa
gcggtcacgctgcaggacgccgcgcgcctcacccgcgtgcccggcatcggcaagaaaacg
gccgagcgcctgctcctcgagctgaaaggcaagctcggcgccgatctcggcccgctcgcc
ggcgcggcatcgccttccgaccatgcgaccgacatcctcaacgcgctcgtcgcgctcggc
tactcggaaaaggaggcgcttgccgcgatcaagaacgtgccggccggcaccggcgtgtcc
gaaggcatcaagctgtcgctcaaggcgctgtcgaaggcgtaa

DBGET integrated database retrieval system