KEGG   Burkholderia pseudomallei K96243: BPSL3103
Entry
BPSL3103          CDS       T00203                                 

Definition
(RefSeq) hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
bps  Burkholderia pseudomallei K96243
Brite
KEGG Orthology (KO) [BR:bps00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bps02044]
    BPSL3103
Secretion system [BR:bps02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BPSL3103
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-GeneID: 3092705
NCBI-ProteinID: YP_109698
UniProt: Q63QC0
Position
1:complement(3708183..3710009)
AA seq 608 aa
MPYYERELSFLRRYSLEFANRYPKIAARLAQTGEQCEDPHVERMIESFALLGARINKKLD
DEYPEFTEALVEVLYPHYLRPFPSCSIAQFGAPHAFAELTEPRIVERGTELKSRAIRGVQ
CRFRTAYDVTLAPIRLADARYGSVAVAPAAARLPGNATGVISIAFESTSPQLDLAALKLG
KLRAHLHGEQSFVAALADCLFAHALACYVEPDRGGRWIALGKTPFEHAGFDETDALIDYP
ARSHPAYRLLTEYFAFPDKFNFVDFDLGALARRAGPCRQLTLHIALRDVRGDSHVARLLD
LLSASHFRLFCTPVVNLFRQHGEPIRVDHRAVSYPVIGDARRAFAYEVYSIDSVHLVRQR
ADRETLVEFRPFYSLHHGEAAQAGHYWFARRNDDVARKSPGYETEISVVDVDFEPGAPQT
DTLSLDLTCTNRDLPAALATGLDGGDLFIDGGEQPGPIALLRRPTPSARFERGHAAHWRL
VSHLALNHVSLAEEGLAALKEALVLYDLRRSAVSTRHIDGIVGIEQKSAVQWLPGKPFAT
FVRGVEIRLAIDDEHFVGSSLATFVRMIDAFFGLYVHLNSFVQLIVVSRRTGEEIMRCKP
RSGESILA
NT seq 1827 nt   +upstreamnt  +downstreamnt
ttgccgtattacgaacgcgaactgtcgtttctgcggcgctattcgctcgaattcgcgaac
cgttacccgaagatcgccgcgcgtctcgcccagacgggcgagcagtgtgaggatccgcac
gtcgagcggatgatcgaatcgttcgcgctgctcggcgcgcggatcaacaagaagctcgac
gacgaatatcccgagttcaccgaagcgctcgtcgaagtcctctacccgcactatctgcgg
ccgttcccgtcatgctcgatcgcgcagttcggtgcgccgcatgcgttcgcggagctcacc
gagccgcggatcgtcgagcgcggcaccgagctgaagagccgcgcgattcgcggcgtgcag
tgccggttccgcaccgcgtacgacgtgacgctcgcgccgatccggctcgccgatgcgcgc
tacggatcggtcgcggtggcgcccgccgcagcaaggctgcccggcaacgcgacgggcgtg
atctcgatcgcgttcgaatcgacgtcgccgcagctcgatctcgccgcgctgaagctcggc
aagctgcgcgcgcatttgcacggcgagcaatcgttcgtcgccgcgctggccgattgcctg
ttcgcgcacgcgctcgcctgctacgtcgagcccgatcgcggcggccgctggatcgcgctc
ggcaagacgccgttcgagcacgcgggcttcgacgagaccgacgcgctgatcgactatccg
gcccgttcgcatccggcctatcggctgctgaccgaatacttcgcattcccggataaattc
aacttcgtcgatttcgatctgggcgcgctcgcgcggcgcgcggggccctgccggcagctg
acgctgcacatcgcgctgcgcgacgtgcgcggcgattcgcatgtcgcgcggctgctcgat
ctgctgagcgcgagccatttccggctcttctgcacgccggtcgtgaacctgttccgccag
cacggcgagccgattcgggtcgaccaccgggcggtgtcgtacccggtgatcggcgatgcg
cgccgcgcgttcgcgtacgaggtatattcgatcgattcggtgcatctcgtgcggcagcgc
gcggaccgcgaaacgctcgtcgaattccggccgttctattcgctgcatcacggcgaagcc
gcgcaggccggccactactggttcgcgcggcgcaacgacgacgtcgcgcgcaagagcccc
ggctacgagaccgagatttcggtcgtcgacgtcgacttcgagccgggcgcgccgcaaacc
gatacgttgagcctcgatctcacctgtacgaaccgcgacctgcccgccgcgctcgcaacg
gggctcgacggcggcgatctcttcatcgacggcggcgagcagcccggcccgatcgcgcta
ttgcgccggccgacgccgagcgcgcgcttcgagcgcggccacgccgcgcactggcgcctc
gtgtcgcatctcgcgctcaatcacgtgtcgcttgccgaagaagggctcgccgcgctgaag
gaagcgctcgtgctgtacgatctgaggcgctccgcggtgtcgacgcgccatatcgacggg
atcgtcggcatcgagcagaagagcgcggtgcaatggctgccgggcaagccgttcgcgacg
ttcgtgcgcggcgtcgagatccggctcgcgatcgacgacgaacatttcgtcggctcgagc
ctcgcgacgttcgtgcggatgatcgacgcgttcttcgggctgtacgtgcacctcaacagc
tttgttcaactgatcgtcgtgtccaggcgcaccggcgaggagatcatgcgatgcaaaccg
cgcagcggcgaatcgatcctggcgtag

DBGET integrated database retrieval system