KEGG   Burkholderia pseudomallei K96243: BPSL3106
Entry
BPSL3106          CDS       T00203                                 

Definition
(RefSeq) hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
bps  Burkholderia pseudomallei K96243
Brite
KEGG Orthology (KO) [BR:bps00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bps02044]
    BPSL3106
Secretion system [BR:bps02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BPSL3106
SSDB
Motif
Pfam: VipB VipB_2 Sox_N
Other DBs
NCBI-GeneID: 3093076
NCBI-ProteinID: YP_109701
UniProt: Q63QB7
Position
1:complement(3711217..3712707)
AA seq 496 aa
MNQQTAAAQSTGVQAGTESSLLDEIVEKSKVAKSESEHARAKDLIGELVSQVLDGTVVVS
DNLSATIDARVAELDRLISSQLSAVMHAAEFQRLESTWRGLDYLVKESNTGSTIKIKALH
APKRDLVRDFKNATEFDQSALFKKVYEEEFGTFGGSPFGVLVGDYEISRQPEDQYFIEQM
SHVAAAAHAPFIASAAPELLGLESFADLGKPRDLGKVFDTVEYAKWKSFRDSEDSRYVGL
TLPRFLGRLPFNPKDGAIAESFNFVEDVDGTDHDKYLWCNASWAFAARLTAAFDDFGWCA
AIRGVEGGGLVEDLPTHTFKTDDGEIALKCPTEIAITDRREKELSDLGFIPLVHCKNSDY
AAFFAAQSVQKPKKYSTDSANANAVLSAQLQYIFSVSRIAHYLKAMMRDKIGSFASAQNV
ETFLNRWISQYVLLDDDATQEQKAQFPLREASVQVSEIPGKPGAYRSVAFLRPHFQLDEL
SISLRLVADLPKPANS
NT seq 1491 nt   +upstreamnt  +downstreamnt
atgaaccagcaaacggctgcggcccaatccaccggcgttcaagccggcacggaatcctcg
ctgctcgacgagatcgtcgagaagagcaaggtcgcgaaatccgaatccgagcatgcgcgc
gcgaaggatctgatcggcgagctcgtcagtcaggtgcttgacggcacggtggtggtgtcg
gacaacctgtcggcgaccatcgacgcgcgcgtcgcggagctcgatcgcctgatctcgtcg
cagctctcggccgtgatgcacgcggcggagttccagcgtctcgagagcacctggcgcggg
ctcgattacctggtgaaggaaagcaacaccggctcgacgatcaagatcaaggcgctgcac
gcgccgaagcgcgatctcgtgcgcgatttcaagaacgcgaccgagttcgatcagagcgcg
ctcttcaagaaggtgtacgaagaggaattcggcacgttcggcggctcgccgttcggcgtg
ctggtgggcgactacgagatctcgcgccagccggaagaccagtacttcatcgagcagatg
tcgcacgtcgcggccgccgcgcacgcgccgttcatcgcgtcggcggcgcccgagctgctc
gggctcgaatcgttcgcggatctcggcaagccgcgcgatctcggcaaggtgttcgatacc
gttgaatacgcgaagtggaagtcgttccgcgattccgaggattcgcgctacgtcggcctc
acgctgccgcgctttctcggccgcctgccgttcaatccgaaggacggcgcgatcgcggag
agcttcaacttcgtcgaggacgtcgacggcaccgatcacgacaagtacctgtggtgcaac
gcgtcgtgggcgttcgccgcgcgcctgacggcggcgttcgacgacttcggctggtgcgcg
gcgattcgcggcgtcgaaggcggcggcctcgtcgaggatctgccgacccacacgttcaag
accgacgacggcgaaatcgcgctcaagtgcccgaccgagatcgcgatcaccgaccgccgc
gagaaggaactgagcgatctcggtttcatcccgctcgtgcactgcaagaattccgattac
gccgcgttctttgccgcgcagtcggtgcagaaacccaagaaatacagcaccgacagcgcc
aacgcgaacgccgtcctgtccgctcagctgcagtacatcttctcggtatcgcgcatcgcg
cattacctgaaggcgatgatgcgcgacaagatcggcagcttcgcgtccgcgcagaacgtc
gaaacgttcctcaatcgctggatctcgcagtacgtgttgctcgacgacgacgcgacgcag
gaacagaaggcgcagttcccgctgcgcgaggcctccgtacaagtgtcagagattccgggc
aagccgggtgcgtatcgttcggtcgcgtttttgcgtccgcacttccagctcgacgagttg
tcgatttctctgcgccttgtcgctgatctgcccaaaccggcaaattcataa

DBGET integrated database retrieval system