KEGG   Burkholderia pseudomallei K96243: BPSL3107
Entry
BPSL3107          CDS       T00203                                 

Definition
(RefSeq) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
bps  Burkholderia pseudomallei K96243
Brite
KEGG Orthology (KO) [BR:bps00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bps02044]
    BPSL3107
Secretion system [BR:bps02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BPSL3107
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-GeneID: 3093725
NCBI-ProteinID: YP_109702
UniProt: Q63QB6
Position
1:complement(3712724..3713242)
AA seq 172 aa
MAKKESIQKRLQKVRPPRVQLTYEVERGDAIEIKELPFVVGVVGDLAGQSEIEQPKLRDR
KFVNIDRDNFDDVMKAIEPRATFQVENRLSEAGGKFAVDLKFRSINDFNPDEVVGQVEPL
RRLLEARSKLADLRNKLAGNDKLEDLLSEVLSNTQQLEALKKSADGGDKQGE
NT seq 519 nt   +upstreamnt  +downstreamnt
atggcgaagaaagaaagcattcaaaagcgcttgcagaaagtgcggccgccccgcgtccag
ttgacgtacgaggtcgaacggggcgatgcgatcgagatcaaggagctgccgttcgtcgtc
ggggtcgtcggcgatctggcggggcagtccgaaatcgagcagccgaagctgcgcgatcgc
aagttcgtcaacatcgaccgcgacaacttcgatgacgtgatgaaggcgatcgagccgcgc
gcgacgttccaggtggagaaccgcctgagcgaggcgggcggcaagttcgcggtcgacctg
aagttccgctcgatcaacgatttcaatccggacgaagtcgtcgggcaggtcgagccgctg
cgccgcctgctcgaggcgcgctcgaagctcgcggacctgcgcaacaaactggccggcaac
gacaagctcgaagacctgctgagcgaagtgctgtcgaacacgcagcagctcgaagcgctg
aagaagagcgcggacggcggcgacaagcagggcgaatga

DBGET integrated database retrieval system